Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 4195167..4195948 | Replicon | chromosome |
Accession | NZ_CP126341 | ||
Organism | Enterobacter cloacae strain TL15 |
Toxin (Protein)
Gene name | TacT2 | Uniprot ID | - |
Locus tag | QN095_RS19885 | Protein ID | WP_284557617.1 |
Coordinates | 4195167..4195658 (-) | Length | 164 a.a. |
Antitoxin (Protein)
Gene name | TacA2 | Uniprot ID | A0A5E1AUV7 |
Locus tag | QN095_RS19890 | Protein ID | WP_029882966.1 |
Coordinates | 4195655..4195948 (-) | Length | 98 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QN095_RS19865 (QN095_19865) | 4190907..4191599 | + | 693 | WP_013098687.1 | response regulator | - |
QN095_RS19870 (QN095_19870) | 4191698..4193833 | - | 2136 | WP_161670618.1 | ornithine decarboxylase | - |
QN095_RS19875 (QN095_19875) | 4194016..4194729 | + | 714 | WP_013098689.1 | DUF554 domain-containing protein | - |
QN095_RS19885 (QN095_19885) | 4195167..4195658 | - | 492 | WP_284557617.1 | GNAT family N-acetyltransferase | Toxin |
QN095_RS19890 (QN095_19890) | 4195655..4195948 | - | 294 | WP_029882966.1 | DUF1778 domain-containing protein | Antitoxin |
QN095_RS19895 (QN095_19895) | 4196197..4197984 | - | 1788 | WP_038983508.1 | hybrid sensor histidine kinase/response regulator | - |
QN095_RS19900 (QN095_19900) | 4197981..4198613 | - | 633 | WP_013098693.1 | response regulator transcription factor | - |
QN095_RS19905 (QN095_19905) | 4198789..4199103 | + | 315 | WP_013098694.1 | lipoprotein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 164 a.a. Molecular weight: 17629.53 Da Isoelectric Point: 7.2653
>T282842 WP_284557617.1 NZ_CP126341:c4195658-4195167 [Enterobacter cloacae]
MISAPEPLHAGHIITPFCCGVDSMDNWLKQRAMKNQVSGASRTFVCCGNDSNVLAYYSLASSAVMTNTAPGRFRRNMPDP
IPVVVLGRLAVDQSLHGQGVGRALVRDAGLRVIQVAETIGIRGMLVHALSDEAREFYLRVGFEPSPMDPMILMVTLGDLM
ASI
MISAPEPLHAGHIITPFCCGVDSMDNWLKQRAMKNQVSGASRTFVCCGNDSNVLAYYSLASSAVMTNTAPGRFRRNMPDP
IPVVVLGRLAVDQSLHGQGVGRALVRDAGLRVIQVAETIGIRGMLVHALSDEAREFYLRVGFEPSPMDPMILMVTLGDLM
ASI
Download Length: 492 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|