Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 1252411..1253031 | Replicon | chromosome |
Accession | NZ_CP126341 | ||
Organism | Enterobacter cloacae strain TL15 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | A0A5E1A1U8 |
Locus tag | QN095_RS05895 | Protein ID | WP_013095889.1 |
Coordinates | 1252411..1252629 (-) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | V3PBI9 |
Locus tag | QN095_RS05900 | Protein ID | WP_008499288.1 |
Coordinates | 1252657..1253031 (-) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QN095_RS05865 (QN095_05865) | 1248423..1248683 | + | 261 | WP_006176933.1 | type B 50S ribosomal protein L31 | - |
QN095_RS05870 (QN095_05870) | 1248686..1248826 | + | 141 | WP_003859006.1 | type B 50S ribosomal protein L36 | - |
QN095_RS05875 (QN095_05875) | 1248823..1249533 | - | 711 | WP_023620096.1 | GNAT family protein | - |
QN095_RS05880 (QN095_05880) | 1249635..1251095 | + | 1461 | WP_150057013.1 | PLP-dependent aminotransferase family protein | - |
QN095_RS05885 (QN095_05885) | 1251067..1251534 | - | 468 | WP_013095887.1 | YlaC family protein | - |
QN095_RS05890 (QN095_05890) | 1251650..1252201 | - | 552 | WP_013095888.1 | maltose O-acetyltransferase | - |
QN095_RS05895 (QN095_05895) | 1252411..1252629 | - | 219 | WP_013095889.1 | HHA domain-containing protein | Toxin |
QN095_RS05900 (QN095_05900) | 1252657..1253031 | - | 375 | WP_008499288.1 | Hha toxicity modulator TomB | Antitoxin |
QN095_RS05905 (QN095_05905) | 1253544..1256690 | - | 3147 | WP_013095890.1 | multidrug efflux RND transporter permease subunit AcrB | - |
QN095_RS05910 (QN095_05910) | 1256713..1257906 | - | 1194 | WP_023620093.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8625.98 Da Isoelectric Point: 8.9008
>T282835 WP_013095889.1 NZ_CP126341:c1252629-1252411 [Enterobacter cloacae]
MSDKPLTKTDYLMRLRRCQSIDTLERVIEKNKYELSDNELTVFYSAADHRLAELTMNKLYDKIPPSVWKFVR
MSDKPLTKTDYLMRLRRCQSIDTLERVIEKNKYELSDNELTVFYSAADHRLAELTMNKLYDKIPPSVWKFVR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14481.28 Da Isoelectric Point: 4.8886
>AT282835 WP_008499288.1 NZ_CP126341:c1253031-1252657 [Enterobacter cloacae]
MDEYSPKRHDIAQLKFLCESLYHDCLANLDESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINAQDLQKWRKSGNRLFRCFVNVSRANPVSLSC
MDEYSPKRHDIAQLKFLCESLYHDCLANLDESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINAQDLQKWRKSGNRLFRCFVNVSRANPVSLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5E1A1U8 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | V3PBI9 |