Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | KacT-ataR/DUF1778(antitoxin) |
| Location | 712545..713339 | Replicon | chromosome |
| Accession | NZ_CP126341 | ||
| Organism | Enterobacter cloacae strain TL15 | ||
Toxin (Protein)
| Gene name | KacT | Uniprot ID | - |
| Locus tag | QN095_RS03390 | Protein ID | WP_038418617.1 |
| Coordinates | 712545..713066 (-) | Length | 174 a.a. |
Antitoxin (Protein)
| Gene name | ataR | Uniprot ID | A0A5E1AP76 |
| Locus tag | QN095_RS03395 | Protein ID | WP_013095428.1 |
| Coordinates | 713070..713339 (-) | Length | 90 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QN095_RS03365 (QN095_03365) | 707872..708033 | + | 162 | WP_020687816.1 | DUF1127 domain-containing protein | - |
| QN095_RS03370 (QN095_03370) | 708120..709508 | - | 1389 | WP_047023206.1 | PLP-dependent aminotransferase family protein | - |
| QN095_RS03375 (QN095_03375) | 709611..710090 | + | 480 | WP_013095424.1 | carboxymuconolactone decarboxylase family protein | - |
| QN095_RS03380 (QN095_03380) | 710077..710979 | - | 903 | WP_094085398.1 | LysR family transcriptional regulator | - |
| QN095_RS03385 (QN095_03385) | 711080..712495 | + | 1416 | WP_161670545.1 | aldehyde dehydrogenase family protein | - |
| QN095_RS03390 (QN095_03390) | 712545..713066 | - | 522 | WP_038418617.1 | GNAT family N-acetyltransferase | Toxin |
| QN095_RS03395 (QN095_03395) | 713070..713339 | - | 270 | WP_013095428.1 | DUF1778 domain-containing protein | Antitoxin |
| QN095_RS03400 (QN095_03400) | 713554..713877 | + | 324 | WP_284557736.1 | antibiotic biosynthesis monooxygenase | - |
| QN095_RS03405 (QN095_03405) | 713870..714268 | + | 399 | WP_029882197.1 | hypothetical protein | - |
| QN095_RS03410 (QN095_03410) | 714240..714935 | + | 696 | WP_038418621.1 | winged helix-turn-helix domain-containing protein | - |
| QN095_RS03415 (QN095_03415) | 715054..716200 | + | 1147 | Protein_664 | IS481 family transposase | - |
| QN095_RS03420 (QN095_03420) | 716423..716893 | + | 471 | WP_013095432.1 | MarR family transcriptional regulator | - |
| QN095_RS03425 (QN095_03425) | 716890..717957 | + | 1068 | WP_114519182.1 | HlyD family secretion protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 174 a.a. Molecular weight: 19352.30 Da Isoelectric Point: 9.4920
>T282834 WP_038418617.1 NZ_CP126341:c713066-712545 [Enterobacter cloacae]
VNNMKIGIFSDDVEYDLSHFDCGEESLNTFLTAHLKRQHRGKFLRGYVLVASGEKPRVLGYYTLSGSCFEKAYLPSKTQQ
KRVPYKNVPSVTLGRLAIDKRFQGQGLGELLVTHALKTVYLASFAVGIHGIFVEALNGSAKNFYLKLGFIALQAENENTL
FLPTKTIERLFAD
VNNMKIGIFSDDVEYDLSHFDCGEESLNTFLTAHLKRQHRGKFLRGYVLVASGEKPRVLGYYTLSGSCFEKAYLPSKTQQ
KRVPYKNVPSVTLGRLAIDKRFQGQGLGELLVTHALKTVYLASFAVGIHGIFVEALNGSAKNFYLKLGFIALQAENENTL
FLPTKTIERLFAD
Download Length: 522 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|