Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-RelB |
Location | 633627..634143 | Replicon | chromosome |
Accession | NZ_CP126341 | ||
Organism | Enterobacter cloacae strain TL15 |
Toxin (Protein)
Gene name | relE | Uniprot ID | A0A5E1ALA9 |
Locus tag | QN095_RS03050 | Protein ID | WP_038985641.1 |
Coordinates | 633859..634143 (+) | Length | 95 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | V3EXX3 |
Locus tag | QN095_RS03045 | Protein ID | WP_008501400.1 |
Coordinates | 633627..633869 (+) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QN095_RS03030 (QN095_03030) | 629616..630356 | + | 741 | WP_094085364.1 | KDGP aldolase family protein | - |
QN095_RS03035 (QN095_03035) | 630480..631619 | + | 1140 | WP_095453858.1 | lactonase family protein | - |
QN095_RS03040 (QN095_03040) | 631639..633549 | + | 1911 | WP_161670021.1 | PRD domain-containing protein | - |
QN095_RS03045 (QN095_03045) | 633627..633869 | + | 243 | WP_008501400.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
QN095_RS03050 (QN095_03050) | 633859..634143 | + | 285 | WP_038985641.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
QN095_RS03055 (QN095_03055) | 634147..634611 | - | 465 | WP_161670019.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
QN095_RS03060 (QN095_03060) | 634734..636872 | - | 2139 | WP_013095357.1 | anaerobic ribonucleoside-triphosphate reductase | - |
QN095_RS03065 (QN095_03065) | 637246..638889 | - | 1644 | WP_161670018.1 | alpha,alpha-phosphotrehalase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 11014.93 Da Isoelectric Point: 10.4610
>T282833 WP_038985641.1 NZ_CP126341:633859-634143 [Enterobacter cloacae]
MTYELEFDPRALKEWSKLGETVKKQFRKKLAGVLVNPRIESARLHNLPDCYKIKLRSQGYRLVYQVQDNVVTVVVIAIGK
REKLTVYHDANKRL
MTYELEFDPRALKEWSKLGETVKKQFRKKLAGVLVNPRIESARLHNLPDCYKIKLRSQGYRLVYQVQDNVVTVVVIAIGK
REKLTVYHDANKRL
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5E1ALA9 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | V3EXX3 |