Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/HicA-HicB |
| Location | 181762..182366 | Replicon | chromosome |
| Accession | NZ_CP126341 | ||
| Organism | Enterobacter cloacae strain TL15 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | - |
| Locus tag | QN095_RS00875 | Protein ID | WP_161670311.1 |
| Coordinates | 181762..181947 (+) | Length | 62 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | A0A5E1AFC9 |
| Locus tag | QN095_RS00880 | Protein ID | WP_023621194.1 |
| Coordinates | 181962..182366 (+) | Length | 135 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QN095_RS00860 (QN095_00860) | 178193..179731 | + | 1539 | WP_020686520.1 | aldehyde dehydrogenase family protein | - |
| QN095_RS00865 (QN095_00865) | 179728..180693 | - | 966 | WP_061771396.1 | LysR family transcriptional regulator | - |
| QN095_RS00870 (QN095_00870) | 180811..181551 | + | 741 | WP_013094942.1 | MipA/OmpV family protein | - |
| QN095_RS00875 (QN095_00875) | 181762..181947 | + | 186 | WP_161670311.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| QN095_RS00880 (QN095_00880) | 181962..182366 | + | 405 | WP_023621194.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| QN095_RS00885 (QN095_00885) | 182420..184375 | - | 1956 | WP_161670310.1 | glycoside hydrolase family 127 protein | - |
| QN095_RS00890 (QN095_00890) | 184386..185786 | - | 1401 | WP_161670309.1 | MFS transporter | - |
| QN095_RS00895 (QN095_00895) | 186011..186829 | + | 819 | WP_020686525.1 | helix-turn-helix domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 62 a.a. Molecular weight: 6901.16 Da Isoelectric Point: 11.7891
>T282831 WP_161670311.1 NZ_CP126341:181762-181947 [Enterobacter cloacae]
VKSADVITVLVRHGWKCVRTKVSHHQFRHPVHAGLVTVPHPKKDIKPGTLAQIWRQAGIKH
VKSADVITVLVRHGWKCVRTKVSHHQFRHPVHAGLVTVPHPKKDIKPGTLAQIWRQAGIKH
Download Length: 186 bp
Antitoxin
Download Length: 135 a.a. Molecular weight: 14888.72 Da Isoelectric Point: 4.3036
>AT282831 WP_023621194.1 NZ_CP126341:181962-182366 [Enterobacter cloacae]
MFYPAYIHSDPDGSASGFFPDVPGCFFAGNSLDDAFQDARDALTAHFEALFEMDEELPLPGNVEAHLEATPGDFIGGQWL
LVDINMKQFDGKAERINITLPRRLLVKIDSFVSEHPQFSNRSAFLAEAARRVLP
MFYPAYIHSDPDGSASGFFPDVPGCFFAGNSLDDAFQDARDALTAHFEALFEMDEELPLPGNVEAHLEATPGDFIGGQWL
LVDINMKQFDGKAERINITLPRRLLVKIDSFVSEHPQFSNRSAFLAEAARRVLP
Download Length: 405 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|