Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-MazE |
| Location | 59612..60274 | Replicon | chromosome |
| Accession | NZ_CP126341 | ||
| Organism | Enterobacter cloacae strain TL15 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | QN095_RS00295 | Protein ID | WP_020686448.1 |
| Coordinates | 59876..60274 (+) | Length | 133 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | A0A5E1AFU3 |
| Locus tag | QN095_RS00290 | Protein ID | WP_020686447.1 |
| Coordinates | 59612..59872 (+) | Length | 87 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QN095_RS00275 (QN095_00275) | 57038..58159 | - | 1122 | WP_097535494.1 | efflux RND transporter periplasmic adaptor subunit | - |
| QN095_RS00280 (QN095_00280) | 58308..58877 | - | 570 | WP_013094828.1 | TetR/AcrR family transcriptional regulator | - |
| QN095_RS00285 (QN095_00285) | 59065..59484 | + | 420 | WP_048972221.1 | GNAT family N-acetyltransferase | - |
| QN095_RS00290 (QN095_00290) | 59612..59872 | + | 261 | WP_020686447.1 | virulence protein | Antitoxin |
| QN095_RS00295 (QN095_00295) | 59876..60274 | + | 399 | WP_020686448.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| QN095_RS00300 (QN095_00300) | 60415..61215 | + | 801 | WP_062856168.1 | lipoprotein NlpA | - |
| QN095_RS00305 (QN095_00305) | 61228..61908 | - | 681 | WP_058682901.1 | EAL domain-containing protein | - |
| QN095_RS00310 (QN095_00310) | 61978..62589 | - | 612 | WP_013094832.1 | LuxR C-terminal-related transcriptional regulator | - |
| QN095_RS00315 (QN095_00315) | 63037..63702 | + | 666 | WP_020686451.1 | LuxR C-terminal-related transcriptional regulator | - |
| QN095_RS00320 (QN095_00320) | 63744..64808 | - | 1065 | WP_013094835.1 | fimbrial protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 14855.11 Da Isoelectric Point: 6.7510
>T282830 WP_020686448.1 NZ_CP126341:59876-60274 [Enterobacter cloacae]
MLHMLDTNIVSHLVRQHPGVIKHYSRTPIEKMCISSVTEAELLYGIAKKQSDRLQKTILEFLKTITICDWDSEAAATYGE
LRAEMEKRGRVMGDLDQLIAAHALSRGTTIVTNDHAFRMVQALAVEDWTTAS
MLHMLDTNIVSHLVRQHPGVIKHYSRTPIEKMCISSVTEAELLYGIAKKQSDRLQKTILEFLKTITICDWDSEAAATYGE
LRAEMEKRGRVMGDLDQLIAAHALSRGTTIVTNDHAFRMVQALAVEDWTTAS
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|