Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 18506..19149 Replicon plasmid pTL13A
Accession NZ_CP126340
Organism Atlantibacter hermannii strain TL13

Toxin (Protein)


Gene name vagD Uniprot ID -
Locus tag QN094_RS20120 Protein ID WP_284556526.1
Coordinates 18733..19149 (+) Length 139 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID -
Locus tag QN094_RS20115 Protein ID WP_284555105.1
Coordinates 18506..18736 (+) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QN094_RS20085 (QN094_20085) 13694..13999 + 306 WP_206160282.1 hypothetical protein -
QN094_RS20090 (QN094_20090) 14871..15083 - 213 WP_284556523.1 hypothetical protein -
QN094_RS20095 (QN094_20095) 15275..15532 + 258 WP_284556524.1 hypothetical protein -
QN094_RS20100 (QN094_20100) 15940..16710 - 771 WP_284556529.1 site-specific integrase -
QN094_RS20105 (QN094_20105) 16793..17509 - 717 WP_284556525.1 hypothetical protein -
QN094_RS20110 (QN094_20110) 17562..17909 - 348 WP_284555106.1 hypothetical protein -
QN094_RS20115 (QN094_20115) 18506..18736 + 231 WP_284555105.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
QN094_RS20120 (QN094_20120) 18733..19149 + 417 WP_284556526.1 type II toxin-antitoxin system VapC family toxin Toxin
QN094_RS20125 (QN094_20125) 19323..19526 + 204 Protein_25 IS6 family transposase -
QN094_RS20130 (QN094_20130) 19600..20304 + 705 WP_001067848.1 IS6-like element IS26 family transposase -
QN094_RS20135 (QN094_20135) 20511..20849 - 339 WP_002310911.1 hypothetical protein -
QN094_RS20140 (QN094_20140) 20753..21943 - 1191 WP_000841446.1 tetracycline efflux MFS transporter Tet(C) -
QN094_RS20145 (QN094_20145) 22036..22695 + 660 WP_001038045.1 tetracycline resistance transcriptional repressor TetR(C) -
QN094_RS20150 (QN094_20150) 22682..23221 + 540 Protein_30 helix-turn-helix transcriptional regulator -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid tet(C) / blaTEM-1A / floR / aac(6')-Ib-cr / ARR-3 / dfrA27 / aadA16 / qacE / sul1 / qnrB6 - 1..106199 106199


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(5-129)

Antitoxin

SpoVT-AbrB domain

(7-50)


Sequences

Toxin        


Download         Length: 139 a.a.        Molecular weight: 15012.33 Da        Isoelectric Point: 7.1355

>T282829 WP_284556526.1 NZ_CP126340:18733-19149 [Atlantibacter hermannii]
VNKTYMLDTNICSFIMREQPEAVLKRLEQAVLRNNRIVVSAITYAEMRFGATGPKASPRHTELVDAFCARLDAVLPWDRA
AVDATTEIKVALRLAGTPIGPNDSAIAGHAIAAGAVLVTNNVREFARVPGLILEDWVN

Download         Length: 417 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8744.86 Da        Isoelectric Point: 4.4992

>AT282829 WP_284555105.1 NZ_CP126340:18506-18736 [Atlantibacter hermannii]
MRTVSIFKNGNNRAIRLPRDLDFEGVSELEIVREGDRIILRPVRPTWGSFAQLEKADPDFMAEREDVVSDEGRVDL

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References