Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 3476564..3477230 | Replicon | chromosome |
Accession | NZ_CP126339 | ||
Organism | Atlantibacter hermannii strain TL13 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | A0A447LT15 |
Locus tag | QN094_RS16150 | Protein ID | WP_040459615.1 |
Coordinates | 3476564..3476983 (-) | Length | 140 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | H5V069 |
Locus tag | QN094_RS16155 | Protein ID | WP_002434469.1 |
Coordinates | 3476964..3477230 (-) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QN094_RS16130 (QN094_16130) | 3472556..3474289 | - | 1734 | WP_148051815.1 | single-stranded-DNA-specific exonuclease RecJ | - |
QN094_RS16135 (QN094_16135) | 3474293..3475012 | - | 720 | WP_002434476.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
QN094_RS16140 (QN094_16140) | 3475038..3475937 | - | 900 | WP_002434475.1 | site-specific tyrosine recombinase XerD | - |
QN094_RS16145 (QN094_16145) | 3476039..3476560 | + | 522 | WP_002434473.1 | flavodoxin FldB | - |
QN094_RS16150 (QN094_16150) | 3476564..3476983 | - | 420 | WP_040459615.1 | protein YgfX | Toxin |
QN094_RS16155 (QN094_16155) | 3476964..3477230 | - | 267 | WP_002434469.1 | FAD assembly factor SdhE | Antitoxin |
QN094_RS16160 (QN094_16160) | 3477489..3478475 | + | 987 | WP_043865941.1 | tRNA-modifying protein YgfZ | - |
QN094_RS16165 (QN094_16165) | 3478631..3479290 | - | 660 | WP_002434465.1 | hemolysin III family protein | - |
QN094_RS16170 (QN094_16170) | 3479420..3479731 | - | 312 | WP_284556470.1 | N(4)-acetylcytidine aminohydrolase | - |
QN094_RS16175 (QN094_16175) | 3479844..3480581 | + | 738 | WP_002434460.1 | MurR/RpiR family transcriptional regulator | - |
QN094_RS16180 (QN094_16180) | 3480708..3482141 | + | 1434 | WP_148053059.1 | 6-phospho-beta-glucosidase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 140 a.a. Molecular weight: 16511.44 Da Isoelectric Point: 10.5604
>T282828 WP_040459615.1 NZ_CP126339:c3476983-3476564 [Atlantibacter hermannii]
VVLWQSDLRVSWRAQWFSLMLHGIVAAIILLLPWPLSYMPLWLILLSLVVFDCVRSQRRIHSLQGEVKLTIDYRLRWQGI
EWELTAAPWMLQSGMLLRLRHPDTHRSQHLWLAADSMDAGEWRDLRRILMQQPQSGRHP
VVLWQSDLRVSWRAQWFSLMLHGIVAAIILLLPWPLSYMPLWLILLSLVVFDCVRSQRRIHSLQGEVKLTIDYRLRWQGI
EWELTAAPWMLQSGMLLRLRHPDTHRSQHLWLAADSMDAGEWRDLRRILMQQPQSGRHP
Download Length: 420 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A447LT15 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | H5V069 |