Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vagCD/VapC-VagC |
Location | 3113313..3113956 | Replicon | chromosome |
Accession | NZ_CP126339 | ||
Organism | Atlantibacter hermannii strain TL13 |
Toxin (Protein)
Gene name | vagD | Uniprot ID | - |
Locus tag | QN094_RS14545 | Protein ID | WP_284555104.1 |
Coordinates | 3113313..3113729 (-) | Length | 139 a.a. |
Antitoxin (Protein)
Gene name | vagC | Uniprot ID | - |
Locus tag | QN094_RS14550 | Protein ID | WP_284555105.1 |
Coordinates | 3113726..3113956 (-) | Length | 77 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QN094_RS14540 (QN094_14540) | 3111940..3113052 | + | 1113 | WP_284555103.1 | EAL domain-containing protein | - |
QN094_RS14545 (QN094_14545) | 3113313..3113729 | - | 417 | WP_284555104.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
QN094_RS14550 (QN094_14550) | 3113726..3113956 | - | 231 | WP_284555105.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
QN094_RS14555 (QN094_14555) | 3114553..3114900 | + | 348 | WP_284555106.1 | hypothetical protein | - |
QN094_RS14560 (QN094_14560) | 3114950..3115501 | + | 552 | WP_284555107.1 | hypothetical protein | - |
QN094_RS14565 (QN094_14565) | 3115601..3116329 | + | 729 | WP_284555108.1 | hypothetical protein | - |
QN094_RS14570 (QN094_14570) | 3116342..3117121 | + | 780 | WP_284555109.1 | site-specific integrase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 3098968..3116329 | 17361 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 15000.28 Da Isoelectric Point: 7.8596
>T282827 WP_284555104.1 NZ_CP126339:c3113729-3113313 [Atlantibacter hermannii]
VNKTYMLDTNICSFIMREQPEAVLKRLEQAVLRNNRIVVSAITYAEMRFGATGPKASPRHTELVDAFCARLDAVLPWDRA
AVDATTEIKVALRLAGTPIGPNDSAIAGHAIAAGAVLVTNNVREFARVPGLTPEDWTK
VNKTYMLDTNICSFIMREQPEAVLKRLEQAVLRNNRIVVSAITYAEMRFGATGPKASPRHTELVDAFCARLDAVLPWDRA
AVDATTEIKVALRLAGTPIGPNDSAIAGHAIAAGAVLVTNNVREFARVPGLTPEDWTK
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|