Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 1107496..1108117 | Replicon | chromosome |
Accession | NZ_CP126339 | ||
Organism | Atlantibacter hermannii strain TL13 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | H5UYE2 |
Locus tag | QN094_RS05200 | Protein ID | WP_001291435.1 |
Coordinates | 1107496..1107714 (-) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | - |
Locus tag | QN094_RS05205 | Protein ID | WP_043866710.1 |
Coordinates | 1107743..1108117 (-) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QN094_RS05165 (QN094_05165) | 1102965..1103345 | + | 381 | WP_251848762.1 | hypothetical protein | - |
QN094_RS05170 (QN094_05170) | 1103718..1103969 | + | 252 | WP_148052435.1 | hypothetical protein | - |
QN094_RS05175 (QN094_05175) | 1103966..1104184 | + | 219 | WP_002463728.1 | hypothetical protein | - |
QN094_RS05180 (QN094_05180) | 1104323..1105873 | - | 1551 | WP_284556170.1 | EAL domain-containing protein | - |
QN094_RS05185 (QN094_05185) | 1106128..1106388 | + | 261 | WP_002463724.1 | type B 50S ribosomal protein L31 | - |
QN094_RS05190 (QN094_05190) | 1106391..1106531 | + | 141 | WP_061708247.1 | type B 50S ribosomal protein L36 | - |
QN094_RS05195 (QN094_05195) | 1106567..1107034 | - | 468 | WP_002463722.1 | YlaC family protein | - |
QN094_RS05200 (QN094_05200) | 1107496..1107714 | - | 219 | WP_001291435.1 | HHA domain-containing protein | Toxin |
QN094_RS05205 (QN094_05205) | 1107743..1108117 | - | 375 | WP_043866710.1 | Hha toxicity modulator TomB | Antitoxin |
QN094_RS05210 (QN094_05210) | 1108589..1111738 | - | 3150 | WP_002463716.1 | multidrug efflux RND transporter permease subunit AcrB | - |
QN094_RS05215 (QN094_05215) | 1111761..1112957 | - | 1197 | WP_002463714.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T282821 WP_001291435.1 NZ_CP126339:c1107714-1107496 [Atlantibacter hermannii]
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14380.16 Da Isoelectric Point: 5.1259
>AT282821 WP_043866710.1 NZ_CP126339:c1108117-1107743 [Atlantibacter hermannii]
MDEYSPKRHDIAQLKFLCENLYHDCLITLGDSNHGWVNDPTSAINLQLNELIEHIASFALNYKIKHDEDNALIEHVDEYL
DDTFMLFSNYGISAQDLQKWRKSGNRLFRCFVNVSKANPVSLSF
MDEYSPKRHDIAQLKFLCENLYHDCLITLGDSNHGWVNDPTSAINLQLNELIEHIASFALNYKIKHDEDNALIEHVDEYL
DDTFMLFSNYGISAQDLQKWRKSGNRLFRCFVNVSKANPVSLSF
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|