Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | ykfI-yfjZ/CbtA-CbeA |
| Location | 544044..544747 | Replicon | chromosome |
| Accession | NZ_CP126339 | ||
| Organism | Atlantibacter hermannii strain TL13 | ||
Toxin (Protein)
| Gene name | ykfI | Uniprot ID | - |
| Locus tag | QN094_RS02620 | Protein ID | WP_049123929.1 |
| Coordinates | 544406..544747 (+) | Length | 114 a.a. |
Antitoxin (Protein)
| Gene name | yfjZ | Uniprot ID | - |
| Locus tag | QN094_RS02615 | Protein ID | WP_075211199.1 |
| Coordinates | 544044..544385 (+) | Length | 114 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QN094_RS02580 (QN094_02580) | 539195..540070 | + | 876 | WP_284556030.1 | GTPase family protein | - |
| QN094_RS02585 (QN094_02585) | 540314..541030 | + | 717 | WP_012543038.1 | WYL domain-containing protein | - |
| QN094_RS02590 (QN094_02590) | 541066..541518 | + | 453 | WP_000734321.1 | hypothetical protein | - |
| QN094_RS02595 (QN094_02595) | 541590..542063 | + | 474 | WP_284556031.1 | hypothetical protein | - |
| QN094_RS02600 (QN094_02600) | 542183..543004 | + | 822 | WP_284556032.1 | DUF932 domain-containing protein | - |
| QN094_RS02605 (QN094_02605) | 543035..543478 | + | 444 | WP_284556033.1 | antirestriction protein | - |
| QN094_RS02610 (QN094_02610) | 543491..544033 | + | 543 | WP_096812530.1 | DNA repair protein RadC | - |
| QN094_RS02615 (QN094_02615) | 544044..544385 | + | 342 | WP_075211199.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| QN094_RS02620 (QN094_02620) | 544406..544747 | + | 342 | WP_049123929.1 | TA system toxin CbtA family protein | Toxin |
| QN094_RS02625 (QN094_02625) | 545011..546018 | + | 1008 | WP_096812529.1 | restriction endonuclease | - |
| QN094_RS02630 (QN094_02630) | 546459..547334 | + | 876 | WP_251850016.1 | HNH endonuclease | - |
| QN094_RS02635 (QN094_02635) | 547514..548524 | + | 1011 | WP_174270262.1 | LacI family DNA-binding transcriptional regulator | - |
| QN094_RS02640 (QN094_02640) | 548572..549000 | - | 429 | WP_002437667.1 | heme-binding protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 526079..546018 | 19939 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 12792.75 Da Isoelectric Point: 8.4941
>T282820 WP_049123929.1 NZ_CP126339:544406-544747 [Atlantibacter hermannii]
MKTLPAITPQAATLYLSPVAVWQMLLARLLEQHYGLTLNDTPFSDETVIQEHIDAGISLADAVNFLVEKYGLVRIDRRGF
DWQEQSPYLRAVDILRARQATGLLKRNRISAAR
MKTLPAITPQAATLYLSPVAVWQMLLARLLEQHYGLTLNDTPFSDETVIQEHIDAGISLADAVNFLVEKYGLVRIDRRGF
DWQEQSPYLRAVDILRARQATGLLKRNRISAAR
Download Length: 342 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|