Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-RelB
Location 282906..283492 Replicon chromosome
Accession NZ_CP126339
Organism Atlantibacter hermannii strain TL13

Toxin (Protein)


Gene name doc Uniprot ID -
Locus tag QN094_RS01290 Protein ID WP_043866378.1
Coordinates 283124..283492 (+) Length 123 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID H5V3H8
Locus tag QN094_RS01285 Protein ID WP_002436532.1
Coordinates 282906..283127 (+) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QN094_RS01260 (QN094_01260) 277989..279104 + 1116 WP_142984558.1 high-affinity branched-chain amino acid ABC transporter substrate-binding protein LivK -
QN094_RS01265 (QN094_01265) 279140..280066 + 927 WP_002436536.1 high-affinity branched-chain amino acid ABC transporter permease LivH -
QN094_RS01270 (QN094_01270) 280063..281340 + 1278 WP_002436535.1 high-affinity branched-chain amino acid ABC transporter permease LivM -
QN094_RS01275 (QN094_01275) 281337..282104 + 768 WP_002436534.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG -
QN094_RS01280 (QN094_01280) 282106..282819 + 714 WP_284555977.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF -
QN094_RS01285 (QN094_01285) 282906..283127 + 222 WP_002436532.1 type II toxin-antitoxin system prevent-host-death family antitoxin Antitoxin
QN094_RS01290 (QN094_01290) 283124..283492 + 369 WP_043866378.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
QN094_RS01295 (QN094_01295) 283670..284983 + 1314 WP_284555978.1 sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB -
QN094_RS01300 (QN094_01300) 285044..285931 + 888 WP_002436527.1 sn-glycerol-3-phosphate ABC transporter permease UgpA -
QN094_RS01305 (QN094_01305) 285928..286773 + 846 WP_043866380.1 sn-glycerol-3-phosphate ABC transporter permease UgpE -
QN094_RS01310 (QN094_01310) 286783..287850 + 1068 WP_284555979.1 sn-glycerol-3-phosphate import ATP-binding protein UgpC -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 280063..288587 8524


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Death on curing protein

(6-121)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-53)


Sequences

Toxin        


Download         Length: 123 a.a.        Molecular weight: 13600.93 Da        Isoelectric Point: 8.5565

>T282818 WP_043866378.1 NZ_CP126339:283124-283492 [Atlantibacter hermannii]
MTIQFISAEEIIRFHDRLLAVTPGVPGMVDPGRAEALLYRVLNKYEYEGVNDLWLLAAMHLLAISRGHIFNDGNKRTALF
ITLLFLKRNGITLPANPAFVELTVAAAAGQLSLEEIARQLRK

Download         Length: 369 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8091.20 Da        Isoelectric Point: 5.6512

>AT282818 WP_002436532.1 NZ_CP126339:282906-283127 [Atlantibacter hermannii]
MQTMNYSEARQNLAAALETAALGTPVTITRRGHKPAVIISAEEFERYQQAKMDAEFAAIMAIHGNEIRELADK

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure
AlphaFold DB H5V3H8

References