Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-RelB
Location 13289..13890 Replicon chromosome
Accession NZ_CP126338
Organism Proteus mirabilis strain W2

Toxin (Protein)


Gene name doc Uniprot ID A0A1Z1SQZ4
Locus tag QN093_RS00060 Protein ID WP_036895893.1
Coordinates 13289..13672 (-) Length 128 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID A0A1Z1SPN9
Locus tag QN093_RS00065 Protein ID WP_004246496.1
Coordinates 13669..13890 (-) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QN093_RS00035 (QN093_00035) 8353..9840 - 1488 WP_049208367.1 PLP-dependent aminotransferase family protein -
QN093_RS00040 (QN093_00040) 9969..10427 + 459 WP_049203077.1 GNAT family N-acetyltransferase -
QN093_RS00045 (QN093_00045) 10523..11260 - 738 WP_004249950.1 tetratricopeptide repeat protein -
QN093_RS00050 (QN093_00050) 11369..12268 + 900 WP_017826985.1 N-acetylmuramic acid 6-phosphate etherase -
QN093_RS00055 (QN093_00055) 12568..12882 - 315 WP_004246498.1 helix-turn-helix transcriptional regulator -
QN093_RS00060 (QN093_00060) 13289..13672 - 384 WP_036895893.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
QN093_RS00065 (QN093_00065) 13669..13890 - 222 WP_004246496.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
QN093_RS00070 (QN093_00070) 14112..14975 - 864 WP_004249947.1 YicC/YloC family endoribonuclease -
QN093_RS00075 (QN093_00075) 15102..15818 + 717 WP_004249946.1 ribonuclease PH -
QN093_RS00080 (QN093_00080) 15900..16544 + 645 WP_004246493.1 orotate phosphoribosyltransferase -
QN093_RS00085 (QN093_00085) 16863..17468 - 606 WP_004246491.1 nucleoid occlusion factor SlmA -
QN093_RS00090 (QN093_00090) 17588..18046 - 459 WP_004246490.1 dUTP diphosphatase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Death on curing protein

(2-125)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-52)


Sequences

Toxin        


Download         Length: 128 a.a.        Molecular weight: 14518.52 Da        Isoelectric Point: 8.4945

>T282814 WP_036895893.1 NZ_CP126338:c13672-13289 [Proteus mirabilis]
MIWVSAQEVIAFHDRILQRFPGVAGMSDPGRAEALIYRVQNRKHYEGITDVFELAATYWVAIARGRIFNDGNKRTAFFVT
MTFLYRNGIRIRDTDNTLENLTVEAATGEKTVDQLAKHLQNLVEKTN

Download         Length: 384 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8260.23 Da        Isoelectric Point: 5.5667

>AT282814 WP_004246496.1 NZ_CP126338:c13890-13669 [Proteus mirabilis]
MRTYTSTQARANISEVLDIATHGEPVEITRRDGCSAVVISKTEFESYQNAKLDAEFDMMMQRHGHTVEALTNR

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A1Z1SQZ4

Antitoxin

Source ID Structure
AlphaFold DB A0A1Z1SPN9

References