Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/RelE(toxin)
Location 24971..25479 Replicon plasmid pTAFB
Accession NZ_CP126337
Organism Proteus vulgaris strain TAF3

Toxin (Protein)


Gene name relE Uniprot ID -
Locus tag QN092_RS21455 Protein ID WP_050878415.1
Coordinates 25204..25479 (+) Length 92 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID -
Locus tag QN092_RS21450 Protein ID WP_050878414.1
Coordinates 24971..25195 (+) Length 75 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QN092_RS21415 (QN092_21415) 20425..20679 - 255 WP_284551785.1 hypothetical protein -
QN092_RS21420 (QN092_21420) 20686..20970 - 285 WP_284551786.1 hypothetical protein -
QN092_RS21425 (QN092_21425) 21024..21803 - 780 WP_050878406.1 hypothetical protein -
QN092_RS21430 (QN092_21430) 21840..22082 - 243 WP_156734530.1 hypothetical protein -
QN092_RS21435 (QN092_21435) 22160..22495 - 336 WP_050878410.1 hypothetical protein -
QN092_RS21440 (QN092_21440) 23060..23440 - 381 WP_284551787.1 hypothetical protein -
QN092_RS21445 (QN092_21445) 23537..24760 - 1224 WP_284551788.1 DUF3560 domain-containing protein -
QN092_RS21450 (QN092_21450) 24971..25195 + 225 WP_050878414.1 DUF6290 family protein Antitoxin
QN092_RS21455 (QN092_21455) 25204..25479 + 276 WP_050878415.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
QN092_RS21460 (QN092_21460) 25943..26092 + 150 WP_284551789.1 Hok/Gef family protein -
QN092_RS21465 (QN092_21465) 27110..28084 + 975 WP_284551790.1 replication initiation protein -
QN092_RS21470 (QN092_21470) 28068..28868 + 801 WP_284551791.1 GIY-YIG nuclease family protein -
QN092_RS21475 (QN092_21475) 28965..29327 + 363 WP_284551792.1 hypothetical protein -
QN092_RS21480 (QN092_21480) 29409..29702 + 294 WP_050878422.1 sigma factor-like helix-turn-helix DNA-binding protein -
QN092_RS21485 (QN092_21485) 29896..30204 + 309 WP_284551793.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - - 1..40842 40842


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(5-88)

Antitoxin

Protein of unknown function DUF6290

(5-70)


Sequences

Toxin        


Download         Length: 92 a.a.        Molecular weight: 11101.99 Da        Isoelectric Point: 10.1375

>T282813 WP_050878415.1 NZ_CP126337:25204-25479 [Proteus vulgaris]
MDHYRIEYTKRFQKEIKKIDKYHQKIIQNYIEKHIDNSINPRLIGKILKGDKAEFIRYRIGDYRLIATIEDDKLLILALS
IGHRKDIYKHF

Download         Length: 276 bp

Antitoxin


Download         Length: 75 a.a.        Molecular weight: 8490.46 Da        Isoelectric Point: 4.2696

>AT282813 WP_050878414.1 NZ_CP126337:24971-25195 [Proteus vulgaris]
MRKNSTKAIRLNDDELTLFESYANAKGLTFSELCKSAVIEKIEDEIDLKLAEESYNEYLNDNETLSHKALFDSL

Download         Length: 225 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References