Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) mazEF/PRK09907-MazE
Location 104195..104772 Replicon plasmid pTAFA
Accession NZ_CP126336
Organism Proteus vulgaris strain TAF3

Toxin (Protein)


Gene name mazF Uniprot ID -
Locus tag QN092_RS21245 Protein ID WP_071547961.1
Coordinates 104195..104527 (-) Length 111 a.a.

Antitoxin (Protein)


Gene name mazE Uniprot ID U5N340
Locus tag QN092_RS21250 Protein ID WP_023159984.1
Coordinates 104527..104772 (-) Length 82 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QN092_RS21220 (QN092_21220) 100386..100655 + 270 WP_124724886.1 hypothetical protein -
QN092_RS21225 (QN092_21225) 100589..100888 + 300 WP_015639707.1 DUF536 domain-containing protein -
QN092_RS21230 (QN092_21230) 100920..101969 + 1050 WP_159290284.1 23S rRNA (adenine(2503)-C(8))-methyltransferase Cfr -
QN092_RS21235 (QN092_21235) 102308..103012 - 705 WP_001067858.1 IS6-like element IS26 family transposase -
QN092_RS21240 (QN092_21240) 103243..104035 - 793 Protein_113 IS5 family transposase -
QN092_RS21245 (QN092_21245) 104195..104527 - 333 WP_071547961.1 endoribonuclease MazF Toxin
QN092_RS21250 (QN092_21250) 104527..104772 - 246 WP_023159984.1 AbrB/MazE/SpoVT family DNA-binding domain-containing protein Antitoxin
QN092_RS21255 (QN092_21255) 105093..105716 + 624 WP_071547962.1 ParA family partition ATPase -
QN092_RS21260 (QN092_21260) 105808..106035 + 228 WP_071547963.1 plasmid partition protein ParG -
QN092_RS21265 (QN092_21265) 106132..106500 - 369 WP_071547964.1 hypothetical protein -
QN092_RS21270 (QN092_21270) 106863..107255 - 393 WP_071547965.1 hypothetical protein -
QN092_RS21275 (QN092_21275) 107264..107686 - 423 WP_071547966.1 hypothetical protein -
QN092_RS21280 (QN092_21280) 107679..108023 - 345 WP_071547967.1 single-stranded DNA-binding protein -
QN092_RS21285 (QN092_21285) 108026..109072 - 1047 WP_071547968.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid sul1 / qacE / ARR-3 / catB3 / blaOXA-1 / aac(6')-Ib-cr / aac(3)-IVa / aph(4)-Ia / sul2 / floR / mph(E) / msr(E) / cfr - 1..109464 109464


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

mRNA interferase PemK-like

(9-107)

Antitoxin

SpoVT-AbrB domain

(7-49)


Sequences

Toxin        


Download         Length: 111 a.a.        Molecular weight: 12097.88 Da        Isoelectric Point: 7.0813

>T282812 WP_071547961.1 NZ_CP126336:c104527-104195 [Proteus vulgaris]
MVSRYVPDSGDLIWIDFDPVEGHEQGGHRPAVVLSPFAYNNKVGLLLCVPCTTKGKGYPFECEISNERDSYALADQVTCV
DWRARKVTKKGKVEASELAEIKAKAKALIG

Download         Length: 333 bp

Antitoxin


Download         Length: 82 a.a.        Molecular weight: 8786.20 Da        Isoelectric Point: 5.0351

>AT282812 WP_023159984.1 NZ_CP126336:c104772-104527 [Proteus vulgaris]
MAQVTVKKWGNSPSVRLPVAIMQKAALSVDDTVEIAVEEGRIIITPVKAVEYSLDNLLAGITPENIHEKVDFGARTGKEL
I

Download         Length: 246 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure
AlphaFold DB A0A857E7M9

References