Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/ParE-RelB |
| Location | 3969898..3970447 | Replicon | chromosome |
| Accession | NZ_CP126335 | ||
| Organism | Proteus vulgaris strain TAF3 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | A0A6G6SN87 |
| Locus tag | QN092_RS18825 | Protein ID | WP_072070950.1 |
| Coordinates | 3969898..3970203 (-) | Length | 102 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | A0A6G6SPH4 |
| Locus tag | QN092_RS18830 | Protein ID | WP_072070934.1 |
| Coordinates | 3970193..3970447 (-) | Length | 85 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QN092_RS18810 (QN092_18810) | 3965532..3968366 | - | 2835 | WP_072070931.1 | excinuclease ABC subunit UvrA | - |
| QN092_RS18815 (QN092_18815) | 3968619..3969146 | + | 528 | WP_072070932.1 | single-stranded DNA-binding protein SSB1 | - |
| QN092_RS18820 (QN092_18820) | 3969334..3969864 | + | 531 | WP_072070933.1 | zinc uptake transcriptional repressor Zur | - |
| QN092_RS18825 (QN092_18825) | 3969898..3970203 | - | 306 | WP_072070950.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| QN092_RS18830 (QN092_18830) | 3970193..3970447 | - | 255 | WP_072070934.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
| QN092_RS18835 (QN092_18835) | 3970608..3971219 | - | 612 | WP_072070935.1 | transcriptional repressor LexA | - |
| QN092_RS18840 (QN092_18840) | 3971347..3971718 | - | 372 | WP_006536373.1 | diacylglycerol kinase | - |
| QN092_RS18845 (QN092_18845) | 3971849..3974332 | + | 2484 | WP_072070936.1 | glycerol-3-phosphate 1-O-acyltransferase PlsB | - |
| QN092_RS18850 (QN092_18850) | 3974433..3975287 | - | 855 | WP_072070937.1 | 4-hydroxybenzoate octaprenyltransferase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 102 a.a. Molecular weight: 11937.06 Da Isoelectric Point: 10.1010
>T282810 WP_072070950.1 NZ_CP126335:c3970203-3969898 [Proteus vulgaris]
IIFNLEFDKRALKEWQKLDQSIKEQFKKKLKKLQENPYIELARLKDDLAGCYKIKLRASGFRLVYQVIDSEVVILVIAVG
KREESKAYSLAEVRIQKNNMY
IIFNLEFDKRALKEWQKLDQSIKEQFKKKLKKLQENPYIELARLKDDLAGCYKIKLRASGFRLVYQVIDSEVVILVIAVG
KREESKAYSLAEVRIQKNNMY
Download Length: 306 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A6G6SN87 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A6G6SPH4 |