Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relB-yefM/YoeB-RelB
Location 3705785..3706295 Replicon chromosome
Accession NZ_CP126335
Organism Proteus vulgaris strain TAF3

Toxin (Protein)


Gene name relB Uniprot ID -
Locus tag QN092_RS17635 Protein ID WP_019281448.1
Coordinates 3706032..3706295 (+) Length 88 a.a.

Antitoxin (Protein)


Gene name yefM Uniprot ID A0A7X5B7D9
Locus tag QN092_RS17630 Protein ID WP_009836585.1
Coordinates 3705785..3706039 (+) Length 85 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QN092_RS17595 (QN092_17595) 3701381..3701704 + 324 WP_284551167.1 hypothetical protein -
QN092_RS17600 (QN092_17600) 3701733..3701894 + 162 Protein_3421 transposase -
QN092_RS17605 (QN092_17605) 3702104..3702424 - 321 WP_206086774.1 IS66 family insertion sequence element accessory protein TnpB -
QN092_RS17610 (QN092_17610) 3702521..3702813 + 293 Protein_3423 hypothetical protein -
QN092_RS17615 (QN092_17615) 3702958..3704121 + 1164 WP_016243884.1 1,3-propanediol dehydrogenase -
QN092_RS17620 (QN092_17620) 3704138..3704305 + 168 Protein_3425 glycerol dehydratase reactivase beta/small subunit family protein -
QN092_RS17625 (QN092_17625) 3704450..3705424 - 975 WP_284551169.1 IS5-like element IS5 family transposase -
QN092_RS17630 (QN092_17630) 3705785..3706039 + 255 WP_009836585.1 type II toxin-antitoxin system prevent-host-death family antitoxin Antitoxin
QN092_RS17635 (QN092_17635) 3706032..3706295 + 264 WP_019281448.1 Txe/YoeB family addiction module toxin Toxin
QN092_RS17640 (QN092_17640) 3706691..3706918 - 228 Protein_3429 transposase -
QN092_RS17645 (QN092_17645) 3706985..3708167 - 1183 Protein_3430 transposase -
QN092_RS17650 (QN092_17650) 3708222..3708638 + 417 WP_238097239.1 IS200/IS605 family transposase -
QN092_RS17655 (QN092_17655) 3708642..3708863 - 222 WP_284551779.1 hypothetical protein -
QN092_RS17660 (QN092_17660) 3708953..3710025 - 1073 Protein_3433 primase-helicase zinc-binding domain-containing protein -
QN092_RS17665 (QN092_17665) 3710117..3710458 - 342 WP_004249389.1 hypothetical protein -
QN092_RS17670 (QN092_17670) 3710458..3710945 - 488 Protein_3435 JAB domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Integrative and Conjugative Element tet(H) mrkF / mrkD / mrkC / mrkB / mrkA 3564796..3766009 201213
- inside IScluster/Tn - - 3702104..3708638 6534


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin YoeB

(6-87)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-74)


Sequences

Toxin        


Download         Length: 88 a.a.        Molecular weight: 10330.69 Da        Isoelectric Point: 8.8578

>T282808 WP_019281448.1 NZ_CP126335:3706032-3706295 [Proteus vulgaris]
MSSRLLSWTDESWNDYVYWQTQDKKTLKRINKLITDVKRSPFEGIGKPEPLKENLSGFWSRRIDDANRLVYAVDDSAITI
ISCRYHY

Download         Length: 264 bp

Antitoxin


Download         Length: 85 a.a.        Molecular weight: 9462.65 Da        Isoelectric Point: 5.5802

>AT282808 WP_009836585.1 NZ_CP126335:3705785-3706039 [Proteus vulgaris]
MRIVSFTEARNSLKSVLDAVVNDADTTVITRRDSEDAVVMSLDYYNSLMETVHLLRSPANAEHLHRSIAQFKAGKVSQRD
LIDE

Download         Length: 255 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure
AlphaFold DB A0A7X5B7D9

References