Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/PRK09907-MazE |
Location | 3687025..3687602 | Replicon | chromosome |
Accession | NZ_CP126335 | ||
Organism | Proteus vulgaris strain TAF3 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | U5N651 |
Locus tag | QN092_RS17525 | Protein ID | WP_023159957.1 |
Coordinates | 3687270..3687602 (+) | Length | 111 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | - |
Locus tag | QN092_RS17520 | Protein ID | WP_096864992.1 |
Coordinates | 3687025..3687270 (+) | Length | 82 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QN092_RS17495 (QN092_17495) | 3682517..3683374 | - | 858 | WP_196725495.1 | universal stress protein | - |
QN092_RS17500 (QN092_17500) | 3683377..3684855 | - | 1479 | WP_284551165.1 | SulP family inorganic anion transporter | - |
QN092_RS17505 (QN092_17505) | 3685140..3685427 | - | 288 | Protein_3402 | ArsC/Spx/MgsR family protein | - |
QN092_RS17510 (QN092_17510) | 3685773..3686000 | - | 228 | WP_096864993.1 | plasmid partition protein ParG | - |
QN092_RS17515 (QN092_17515) | 3686109..3686732 | - | 624 | WP_250251027.1 | AAA family ATPase | - |
QN092_RS17520 (QN092_17520) | 3687025..3687270 | + | 246 | WP_096864992.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
QN092_RS17525 (QN092_17525) | 3687270..3687602 | + | 333 | WP_023159957.1 | endoribonuclease MazF | Toxin |
QN092_RS17530 (QN092_17530) | 3687633..3688013 | + | 381 | WP_096864991.1 | hypothetical protein | - |
QN092_RS17535 (QN092_17535) | 3688100..3688243 | - | 144 | WP_071547955.1 | Hok/Gef family protein | - |
QN092_RS17540 (QN092_17540) | 3689030..3689727 | + | 698 | WP_211838731.1 | IS1 family transposase | - |
QN092_RS17545 (QN092_17545) | 3689878..3690228 | + | 351 | WP_284551775.1 | N-acetyltransferase | - |
QN092_RS17550 (QN092_17550) | 3690363..3692030 | - | 1668 | WP_206086779.1 | NAD-dependent malic enzyme | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Integrative and Conjugative Element | tet(H) | mrkF / mrkD / mrkC / mrkB / mrkA | 3564796..3766009 | 201213 | |
- | flank | IS/Tn | - | - | 3689030..3689305 | 275 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 111 a.a. Molecular weight: 12097.88 Da Isoelectric Point: 7.0813
>T282807 WP_023159957.1 NZ_CP126335:3687270-3687602 [Proteus vulgaris]
MVSRYVPDSGDLIWIDFDPVEGHEQGGHRPAVVLSPFAYNNKVGLLLCVPCTTKGKGYPFECELSNERDSYALADQVTCV
DWRARKVTKKGKVEASELAEIKAKAKALIG
MVSRYVPDSGDLIWIDFDPVEGHEQGGHRPAVVLSPFAYNNKVGLLLCVPCTTKGKGYPFECELSNERDSYALADQVTCV
DWRARKVTKKGKVEASELAEIKAKAKALIG
Download Length: 333 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|