Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/GNAT-DUF1778 |
Location | 2555324..2556063 | Replicon | chromosome |
Accession | NZ_CP126335 | ||
Organism | Proteus vulgaris strain TAF3 |
Toxin (Protein)
Gene name | tacT | Uniprot ID | A0A6G6SNF5 |
Locus tag | QN092_RS12145 | Protein ID | WP_072068519.1 |
Coordinates | 2555578..2556063 (+) | Length | 162 a.a. |
Antitoxin (Protein)
Gene name | tacA | Uniprot ID | A0A6G6SIM7 |
Locus tag | QN092_RS12140 | Protein ID | WP_072068518.1 |
Coordinates | 2555324..2555590 (+) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QN092_RS12105 (QN092_12105) | 2550988..2551470 | + | 483 | WP_006533151.1 | flagellar basal body-associated protein FliL | - |
QN092_RS12110 (QN092_12110) | 2551476..2552504 | + | 1029 | WP_072068513.1 | flagellar motor switch protein FliM | - |
QN092_RS12115 (QN092_12115) | 2552497..2552907 | + | 411 | WP_006533153.1 | flagellar motor switch protein FliN | - |
QN092_RS12120 (QN092_12120) | 2552911..2553357 | + | 447 | WP_072068514.1 | flagellar biosynthetic protein FliO | - |
QN092_RS12125 (QN092_12125) | 2553357..2554127 | + | 771 | WP_072068515.1 | flagellar type III secretion system pore protein FliP | - |
QN092_RS12130 (QN092_12130) | 2554143..2554412 | + | 270 | WP_072068516.1 | flagellar biosynthesis protein FliQ | - |
QN092_RS12135 (QN092_12135) | 2554418..2555200 | + | 783 | WP_072068517.1 | flagellar biosynthetic protein FliR | - |
QN092_RS12140 (QN092_12140) | 2555324..2555590 | + | 267 | WP_072068518.1 | DUF1778 domain-containing protein | Antitoxin |
QN092_RS12145 (QN092_12145) | 2555578..2556063 | + | 486 | WP_072068519.1 | GNAT family N-acetyltransferase | Toxin |
QN092_RS12150 (QN092_12150) | 2556158..2557102 | - | 945 | WP_072068520.1 | flagellar hook-associated protein FlgL | - |
QN092_RS12155 (QN092_12155) | 2557134..2558786 | - | 1653 | WP_072068521.1 | flagellar hook-associated protein FlgK | - |
QN092_RS12160 (QN092_12160) | 2558904..2559890 | - | 987 | WP_072068522.1 | flagellar assembly peptidoglycan hydrolase FlgJ | - |
QN092_RS12165 (QN092_12165) | 2559890..2560996 | - | 1107 | WP_072068523.1 | flagellar basal body P-ring protein FlgI | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 162 a.a. Molecular weight: 17951.68 Da Isoelectric Point: 9.9332
>T282806 WP_072068519.1 NZ_CP126335:2555578-2556063 [Proteus vulgaris]
MGKITAPEPLSNSHEVADFYSSENVLDNWIKQRGLKNQFLGASRTFMVCEKNKKRVVGYYSLATGSVNHTEAISHIRHNM
PDPIPVIILARLAVDKTFHGKGLGADLLRDAVLRCHHVAENIGVRAIMVHALTENAKQFYLHNGFKASSTQENTLFLALK
K
MGKITAPEPLSNSHEVADFYSSENVLDNWIKQRGLKNQFLGASRTFMVCEKNKKRVVGYYSLATGSVNHTEAISHIRHNM
PDPIPVIILARLAVDKTFHGKGLGADLLRDAVLRCHHVAENIGVRAIMVHALTENAKQFYLHNGFKASSTQENTLFLALK
K
Download Length: 486 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A6G6SNF5 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A6G6SIM7 |