Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | hicAB/HicA-HicB |
Location | 1473620..1474265 | Replicon | chromosome |
Accession | NZ_CP126335 | ||
Organism | Proteus vulgaris strain TAF3 |
Toxin (Protein)
Gene name | hicA | Uniprot ID | - |
Locus tag | QN092_RS06740 | Protein ID | WP_284551573.1 |
Coordinates | 1474080..1474265 (-) | Length | 62 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | - |
Locus tag | QN092_RS06735 | Protein ID | WP_164526096.1 |
Coordinates | 1473620..1474033 (-) | Length | 138 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QN092_RS06710 (QN092_06710) | 1469099..1469680 | - | 582 | WP_072069983.1 | hypothetical protein | - |
QN092_RS06715 (QN092_06715) | 1470702..1471928 | - | 1227 | WP_164526095.1 | dNTP triphosphohydrolase | - |
QN092_RS06720 (QN092_06720) | 1472160..1472354 | - | 195 | Protein_1289 | recombinase | - |
QN092_RS06725 (QN092_06725) | 1472485..1472679 | + | 195 | WP_284551572.1 | hypothetical protein | - |
QN092_RS06730 (QN092_06730) | 1472810..1473577 | + | 768 | WP_241254040.1 | phage terminase large subunit | - |
QN092_RS06735 (QN092_06735) | 1473620..1474033 | - | 414 | WP_164526096.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
QN092_RS06740 (QN092_06740) | 1474080..1474265 | - | 186 | WP_284551573.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
QN092_RS06745 (QN092_06745) | 1474375..1474536 | + | 162 | WP_164526098.1 | hypothetical protein | - |
QN092_RS06750 (QN092_06750) | 1474560..1475864 | + | 1305 | WP_241254041.1 | hypothetical protein | - |
QN092_RS06755 (QN092_06755) | 1476072..1476725 | - | 654 | WP_164526099.1 | type A chloramphenicol O-acetyltransferase | - |
QN092_RS06760 (QN092_06760) | 1476835..1477065 | - | 231 | WP_284551574.1 | DNA polymerase III subunit theta | - |
QN092_RS06770 (QN092_06770) | 1477406..1479142 | - | 1737 | WP_115351009.1 | LPS biosynthesis-modulating metalloenzyme YejM | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | cat | - | 1472160..1486561 | 14401 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 62 a.a. Molecular weight: 7035.28 Da Isoelectric Point: 10.9659
>T282805 WP_284551573.1 NZ_CP126335:c1474265-1474080 [Proteus vulgaris]
MKSSELIKLLEKNGWVLDRIKGSHHQFTHPDFSFVVTVPHPRKDLKKGTLNQILKSAKLKN
MKSSELIKLLEKNGWVLDRIKGSHHQFTHPDFSFVVTVPHPRKDLKKGTLNQILKSAKLKN
Download Length: 186 bp
Antitoxin
Download Length: 138 a.a. Molecular weight: 15237.99 Da Isoelectric Point: 4.3830
>AT282805 WP_164526096.1 NZ_CP126335:c1474033-1473620 [Proteus vulgaris]
MLYPAFIEIDEDGSASGWFPDIDGCIFAGDSIEEAHADAKSAIDAHFELLSEKGLDIPSPKSQQEHLINSTGDYNNGIWL
LVDVDMDKYDGRAERINITLPHRLLSRIDTIVKTNPEYGSRSGFIATATRKELQKNI
MLYPAFIEIDEDGSASGWFPDIDGCIFAGDSIEEAHADAKSAIDAHFELLSEKGLDIPSPKSQQEHLINSTGDYNNGIWL
LVDVDMDKYDGRAERINITLPHRLLSRIDTIVKTNPEYGSRSGFIATATRKELQKNI
Download Length: 414 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|