Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-RelB
Location 12269..12867 Replicon chromosome
Accession NZ_CP126335
Organism Proteus vulgaris strain TAF3

Toxin (Protein)


Gene name doc Uniprot ID A0A6G6SCV0
Locus tag QN092_RS00055 Protein ID WP_072070472.1
Coordinates 12269..12649 (-) Length 127 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID A0A6G6SCZ1
Locus tag QN092_RS00060 Protein ID WP_072070471.1
Coordinates 12646..12867 (-) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QN092_RS00030 (QN092_00030) 7724..8293 + 570 WP_072070476.1 rRNA adenine N-6-methyltransferase family protein -
QN092_RS00035 (QN092_00035) 8349..9836 - 1488 WP_284551300.1 PLP-dependent aminotransferase family protein -
QN092_RS00040 (QN092_00040) 9964..10422 + 459 WP_284551301.1 GNAT family N-acetyltransferase -
QN092_RS00045 (QN092_00045) 10516..11253 - 738 WP_284551302.1 tetratricopeptide repeat protein -
QN092_RS00050 (QN092_00050) 11359..12258 + 900 WP_072070473.1 N-acetylmuramic acid 6-phosphate etherase -
QN092_RS00055 (QN092_00055) 12269..12649 - 381 WP_072070472.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
QN092_RS00060 (QN092_00060) 12646..12867 - 222 WP_072070471.1 type II toxin-antitoxin system prevent-host-death family antitoxin Antitoxin
QN092_RS00065 (QN092_00065) 13157..13981 - 825 WP_196737218.1 DNA damage-inducible protein D -
QN092_RS00070 (QN092_00070) 14383..14667 - 285 WP_284551304.1 hypothetical protein -
QN092_RS00075 (QN092_00075) 15828..16244 + 417 WP_105880966.1 hypothetical protein -
QN092_RS00080 (QN092_00080) 16327..16695 + 369 WP_105880965.1 hypothetical protein -
QN092_RS00085 (QN092_00085) 17320..17775 - 456 WP_284551305.1 ProQ/FINO family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 12269..31640 19371


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Fido domain

(4-84)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-52)


Sequences

Toxin        


Download         Length: 127 a.a.        Molecular weight: 14283.27 Da        Isoelectric Point: 7.3135

>T282804 WP_072070472.1 NZ_CP126335:c12649-12269 [Proteus vulgaris]
MNWVSAKEVIAFHDKILKQLPGVAGMSEPGRAEALIYRVQNRTHYEGITDIYELAATYWIAISRGHIFNDGNKRTAFFVT
MTFLYRNGIKIIDIDDTLENLTVDAATGAKNSQQLAQYLRKLSDKD

Download         Length: 381 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8221.23 Da        Isoelectric Point: 6.6412

>AT282804 WP_072070471.1 NZ_CP126335:c12867-12646 [Proteus vulgaris]
MHTYTSTQARAHISEVLDTAIHGEPVEITRRDGTSAVVISKVEFEAYQNAKLDAEFDIIMQRHGHTIKALTNR

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A6G6SCV0

Antitoxin

Source ID Structure
AlphaFold DB A0A6G6SCZ1

References