Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 39396..40039 Replicon plasmid pTHD
Accession NZ_CP126333
Organism Citrobacter braakii strain THB2

Toxin (Protein)


Gene name vagD Uniprot ID Q84A06
Locus tag QN090_RS24085 Protein ID WP_000754566.1
Coordinates 39623..40039 (+) Length 139 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID Q84A07
Locus tag QN090_RS24080 Protein ID WP_001261276.1
Coordinates 39396..39626 (+) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QN090_RS24045 (QN090_24045) 34515..34784 + 270 WP_000339857.1 hypothetical protein -
QN090_RS24050 (QN090_24050) 34961..35827 - 867 WP_004118283.1 replication initiation protein -
QN090_RS24055 (QN090_24055) 36357..36461 + 105 WP_032409716.1 hypothetical protein -
QN090_RS24060 (QN090_24060) 36590..36847 + 258 WP_000764642.1 hypothetical protein -
QN090_RS24065 (QN090_24065) 36905..37681 - 777 WP_000015958.1 site-specific integrase -
QN090_RS24070 (QN090_24070) 37678..38421 - 744 WP_000129823.1 hypothetical protein -
QN090_RS24075 (QN090_24075) 38472..38822 - 351 WP_000493378.1 hypothetical protein -
QN090_RS24080 (QN090_24080) 39396..39626 + 231 WP_001261276.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
QN090_RS24085 (QN090_24085) 39623..40039 + 417 WP_000754566.1 type II toxin-antitoxin system VapC family toxin Toxin
QN090_RS24090 (QN090_24090) 40243..41099 + 857 Protein_47 IS3-like element ISEc15 family transposase -
QN090_RS24095 (QN090_24095) 41381..42457 + 1077 WP_000227969.1 IS110 family transposase -
QN090_RS24100 (QN090_24100) 43098..43181 + 84 Protein_49 SOS response-associated peptidase -
QN090_RS24105 (QN090_24105) 43239..43310 - 72 Protein_50 hypothetical protein -
QN090_RS24110 (QN090_24110) 43344..43865 - 522 Protein_51 Tn3 family transposase -
QN090_RS24115 (QN090_24115) 43933..44637 + 705 WP_001067855.1 IS6-like element IS26 family transposase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Mobilizable plasmid qnrB4 / sul1 / qacE / ARR-3 / catB3 / blaOXA-1 / aac(6')-Ib-cr / mph(A) - 1..54472 54472


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(6-129)

Antitoxin

SpoVT-AbrB domain

(7-47)


Sequences

Toxin        


Download         Length: 139 a.a.        Molecular weight: 15006.52 Da        Isoelectric Point: 9.2957

>T282803 WP_000754566.1 NZ_CP126333:39623-40039 [Citrobacter braakii]
MKKTWMLDTNICSFIMREQPAAVLKRLEQAVLRGDRIVVSAVTYAEMRFGATGPKASPRHIQLVDAFCARLDAVLPWDRA
AVDATTDIRVALRLAGTPIGPNDTAIAGHAIAAGAILVTNNVREFARVPGLVLEDWVK

Download         Length: 417 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8721.74 Da        Isoelectric Point: 4.3533

>AT282803 WP_001261276.1 NZ_CP126333:39396-39626 [Citrobacter braakii]
MRTVSIFKNGNNRAIRLPRDLDFDGVSELEIVREGDSIILRPVRPTWGSFAQLDRADPDFMAEREDVVSDEGRFEP

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A387K1G3

Antitoxin

Source ID Structure
AlphaFold DB A0A387K023

References