Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) parDE/ParE-RHH
Location 48803..49322 Replicon plasmid pTHB
Accession NZ_CP126331
Organism Citrobacter braakii strain THB2

Toxin (Protein)


Gene name parE Uniprot ID Q70W48
Locus tag QN090_RS23470 Protein ID WP_032490867.1
Coordinates 48803..49087 (-) Length 95 a.a.

Antitoxin (Protein)


Gene name parD Uniprot ID A0A5B0K100
Locus tag QN090_RS23475 Protein ID WP_050074632.1
Coordinates 49080..49322 (-) Length 81 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QN090_RS23440 (QN090_23440) 44094..44693 - 600 WP_284564823.1 YkgJ family cysteine cluster protein -
QN090_RS23445 (QN090_23445) 45259..46230 + 972 WP_209634227.1 recombinase family protein -
QN090_RS23450 (QN090_23450) 46321..47012 + 692 WP_284564831.1 IS1 family transposase -
QN090_RS23455 (QN090_23455) 47009..47533 - 525 WP_008815939.1 hypothetical protein -
QN090_RS23460 (QN090_23460) 47786..48405 + 620 Protein_53 ParA family partition ATPase -
QN090_RS23465 (QN090_23465) 48445..48672 + 228 WP_008815937.1 plasmid partition protein ParG -
QN090_RS23470 (QN090_23470) 48803..49087 - 285 WP_032490867.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
QN090_RS23475 (QN090_23475) 49080..49322 - 243 WP_050074632.1 type II toxin-antitoxin system ParD family antitoxin Antitoxin
QN090_RS23480 (QN090_23480) 49894..50811 - 918 WP_149465089.1 plasmid replication initiator RepA -
QN090_RS23485 (QN090_23485) 51319..51684 - 366 WP_181213168.1 helix-turn-helix transcriptional regulator -
QN090_RS23490 (QN090_23490) 52023..52391 + 369 WP_032677090.1 hypothetical protein -
QN090_RS23495 (QN090_23495) 52674..53129 + 456 WP_181213167.1 transcription termination/antitermination NusG family protein -
QN090_RS23500 (QN090_23500) 53194..53415 + 222 WP_284564824.1 hypothetical protein -
QN090_RS23505 (QN090_23505) 53473..54123 + 651 WP_284564832.1 lytic transglycosylase domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - - 1..59549 59549


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(2-88)

Antitoxin

Antitoxin ParD

(1-79)


Sequences

Toxin        


Download         Length: 95 a.a.        Molecular weight: 10989.52 Da        Isoelectric Point: 6.2111

>T282802 WP_032490867.1 NZ_CP126331:c49087-48803 [Citrobacter braakii]
VYKLTERAAEDFAGIYDYTLLKFGEAQADHYTDALEAFFETLAGMPDMGRDYHAVPGVMRIEFQRHAIFYTVRDTDILIA
RILHQQMNHKRHLL

Download         Length: 285 bp

Antitoxin


Download         Length: 81 a.a.        Molecular weight: 8906.02 Da        Isoelectric Point: 5.8317

>AT282802 WP_050074632.1 NZ_CP126331:c49322-49080 [Citrobacter braakii]
MARTTSVTIGEQLDSFISRLIDSGRYGSASEVMRSALRLLEQQETNDEVIRQAVITGLESGESSLSLRDIAAERKLRHRV

Download         Length: 243 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A377TBT2

Antitoxin

Source ID Structure
AlphaFold DB A0A5B0K100

References