Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) parDE/ParE-RHH
Location 19015..19534 Replicon plasmid pTHB
Accession NZ_CP126331
Organism Citrobacter braakii strain THB2

Toxin (Protein)


Gene name parE Uniprot ID Q70W48
Locus tag QN090_RS23300 Protein ID WP_032490867.1
Coordinates 19015..19299 (-) Length 95 a.a.

Antitoxin (Protein)


Gene name parD Uniprot ID A0A5B0K100
Locus tag QN090_RS23305 Protein ID WP_050074632.1
Coordinates 19292..19534 (-) Length 81 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QN090_RS23270 (QN090_23270) 14330..14980 - 651 WP_115105212.1 YkgJ family cysteine cluster protein -
QN090_RS23275 (QN090_23275) 15472..16443 + 972 WP_209634227.1 recombinase family protein -
QN090_RS23280 (QN090_23280) 16534..17225 + 692 WP_284564831.1 IS1 family transposase -
QN090_RS23285 (QN090_23285) 17362..17745 - 384 WP_284564829.1 hypothetical protein -
QN090_RS23290 (QN090_23290) 17998..18617 + 620 Protein_19 ParA family partition ATPase -
QN090_RS23295 (QN090_23295) 18657..18884 + 228 WP_008815937.1 plasmid partition protein ParG -
QN090_RS23300 (QN090_23300) 19015..19299 - 285 WP_032490867.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
QN090_RS23305 (QN090_23305) 19292..19534 - 243 WP_050074632.1 type II toxin-antitoxin system ParD family antitoxin Antitoxin
QN090_RS23310 (QN090_23310) 20106..21023 - 918 WP_149465089.1 plasmid replication initiator RepA -
QN090_RS23315 (QN090_23315) 21528..21893 - 366 WP_181213168.1 helix-turn-helix transcriptional regulator -
QN090_RS23320 (QN090_23320) 22232..22600 + 369 WP_032677090.1 hypothetical protein -
QN090_RS23325 (QN090_23325) 22883..23338 + 456 WP_181213167.1 transcription termination/antitermination NusG family protein -
QN090_RS23330 (QN090_23330) 23403..23627 + 225 WP_115105220.1 hypothetical protein -
QN090_RS23335 (QN090_23335) 23680..24354 + 675 WP_181213166.1 lytic transglycosylase domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - - 1..59549 59549


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(2-88)

Antitoxin

Antitoxin ParD

(1-79)


Sequences

Toxin        


Download         Length: 95 a.a.        Molecular weight: 10989.52 Da        Isoelectric Point: 6.2111

>T282801 WP_032490867.1 NZ_CP126331:c19299-19015 [Citrobacter braakii]
VYKLTERAAEDFAGIYDYTLLKFGEAQADHYTDALEAFFETLAGMPDMGRDYHAVPGVMRIEFQRHAIFYTVRDTDILIA
RILHQQMNHKRHLL

Download         Length: 285 bp

Antitoxin


Download         Length: 81 a.a.        Molecular weight: 8906.02 Da        Isoelectric Point: 5.8317

>AT282801 WP_050074632.1 NZ_CP126331:c19534-19292 [Citrobacter braakii]
MARTTSVTIGEQLDSFISRLIDSGRYGSASEVMRSALRLLEQQETNDEVIRQAVITGLESGESSLSLRDIAAERKLRHRV

Download         Length: 243 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A377TBT2

Antitoxin

Source ID Structure
AlphaFold DB A0A5B0K100

References