Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/LOTUS_5_Limkain_b1(toxin)
Location 4516392..4517008 Replicon chromosome
Accession NZ_CP126329
Organism Citrobacter braakii strain THB2

Toxin (Protein)


Gene name vapC Uniprot ID -
Locus tag QN090_RS21830 Protein ID WP_016155182.1
Coordinates 4516392..4516766 (-) Length 125 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID R8WIS4
Locus tag QN090_RS21835 Protein ID WP_016155181.1
Coordinates 4516766..4517008 (-) Length 81 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QN090_RS21815 (4513895) 4513895..4514797 + 903 WP_003028691.1 formate dehydrogenase O subunit beta -
QN090_RS21820 (4514794) 4514794..4515429 + 636 WP_003028686.1 formate dehydrogenase cytochrome b556 subunit -
QN090_RS21825 (4515426) 4515426..4516355 + 930 WP_003028685.1 formate dehydrogenase accessory protein FdhE -
QN090_RS21830 (4516392) 4516392..4516766 - 375 WP_016155182.1 type II toxin-antitoxin system VapC family toxin Toxin
QN090_RS21835 (4516766) 4516766..4517008 - 243 WP_016155181.1 CopG family transcriptional regulator Antitoxin
QN090_RS21840 (4517214) 4517214..4518143 + 930 WP_075848764.1 alpha/beta hydrolase -
QN090_RS21845 (4518228) 4518228..4518539 + 312 WP_019077936.1 type II toxin-antitoxin system HigB family toxin -
QN090_RS21850 (4518536) 4518536..4518988 + 453 WP_046275270.1 helix-turn-helix domain-containing protein -
QN090_RS21855 (4519006) 4519006..4519947 - 942 WP_003825286.1 fatty acid biosynthesis protein FabY -
QN090_RS21860 (4519992) 4519992..4520429 - 438 WP_016157874.1 D-aminoacyl-tRNA deacylase -
QN090_RS21865 (4520426) 4520426..4521298 - 873 WP_019077938.1 virulence factor BrkB family protein -
QN090_RS21870 (4521292) 4521292..4521891 - 600 WP_016155174.1 glucose-1-phosphatase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(7-113)

Antitoxin

Ribbon-helix-helix protein, CopG

(13-47)


Sequences

Toxin        


Download         Length: 125 a.a.        Molecular weight: 13678.84 Da        Isoelectric Point: 8.5373

>T282798 WP_016155182.1 NZ_CP126329:c4516766-4516392 [Citrobacter braakii]
MVTGSALFDTNILIDLFSGRSEAKLAIETWPPQNAISLITWMELMVGAKKYHQESRTRVALGAFNVIGVSQDIAERSVSI
RQEYGMKLPDAIILATAQIHRLTLVTRNTRDFAGISGVVTPYTL

Download         Length: 375 bp

Antitoxin


Download         Length: 81 a.a.        Molecular weight: 9437.72 Da        Isoelectric Point: 4.3331

>AT282798 WP_016155181.1 NZ_CP126329:c4517008-4516766 [Citrobacter braakii]
MMAGMDMGRILLDLSDEVIKRLDDLKVQRNLPRAELLREAVEQYLERQDQAETTISRALGLWQGCEEDGVDYQRKLREEW

Download         Length: 243 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure
AlphaFold DB R8WIS4

References