Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yfjZ-ypjF/CbtA-CbeA
Location 3957035..3957705 Replicon chromosome
Accession NZ_CP126329
Organism Citrobacter braakii strain THB2

Toxin (Protein)


Gene name ypjF Uniprot ID A0A483GLH7
Locus tag QN090_RS19145 Protein ID WP_023301398.1
Coordinates 3957035..3957367 (-) Length 111 a.a.

Antitoxin (Protein)


Gene name yfjZ Uniprot ID -
Locus tag QN090_RS19150 Protein ID WP_137361087.1
Coordinates 3957388..3957705 (-) Length 106 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QN090_RS19115 (3952700) 3952700..3953062 + 363 WP_016155589.1 endoribonuclease SymE -
QN090_RS19120 (3953125) 3953125..3953610 - 486 WP_137367025.1 type VI secretion system tube protein TssD -
QN090_RS19125 (3953629) 3953629..3953955 - 327 WP_137367026.1 DUF1493 family protein -
QN090_RS19130 (3953949) 3953949..3954398 - 450 WP_137367027.1 hypothetical protein -
QN090_RS19135 (3954657) 3954657..3955529 + 873 WP_137367028.1 HNH endonuclease -
QN090_RS19140 (3955741) 3955741..3956601 - 861 WP_023301399.1 hypothetical protein -
QN090_RS19145 (3957035) 3957035..3957367 - 333 WP_023301398.1 TA system toxin CbtA family protein Toxin
QN090_RS19150 (3957388) 3957388..3957705 - 318 WP_137361087.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
QN090_RS19155 (3957723) 3957723..3957944 - 222 WP_137361086.1 DUF987 domain-containing protein -
QN090_RS19160 (3957953) 3957953..3958435 - 483 WP_284564651.1 RadC family protein -
QN090_RS19165 (3958444) 3958444..3958902 - 459 WP_137361085.1 antirestriction protein -
QN090_RS19170 (3958988) 3958988..3959224 - 237 WP_025760300.1 DUF905 domain-containing protein -
QN090_RS19175 (3959302) 3959302..3959712 - 411 WP_039556163.1 hypothetical protein -
QN090_RS19180 (3959779) 3959779..3960216 - 438 WP_039556164.1 hypothetical protein -
QN090_RS19185 (3960258) 3960258..3960794 - 537 WP_284564652.1 DUF4339 domain-containing protein -
QN090_RS19190 (3960820) 3960820..3961530 - 711 WP_284564653.1 DeoR family transcriptional regulator -
QN090_RS19195 (3961739) 3961739..3962563 - 825 WP_284564654.1 DUF932 domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-101)

Antitoxin

Antitoxin CbeA

(5-104)


Sequences

Toxin        


Download         Length: 111 a.a.        Molecular weight: 12610.65 Da        Isoelectric Point: 5.6692

>T282797 WP_023301398.1 NZ_CP126329:c3957367-3957035 [Citrobacter braakii]
MKTLPATTPQTAKLCLTSADTWQMLLTRLLEQHYGLTLNDTPFSDETVIKEHIDAGIPLADAVNFLVDKYALVRIDRRGL
SWQEQSSYLRLVDTQRTIKVIELWLFGVMM

Download         Length: 333 bp

Antitoxin


Download         Length: 106 a.a.        Molecular weight: 11741.26 Da        Isoelectric Point: 6.6319

>AT282797 WP_137361087.1 NZ_CP126329:c3957705-3957388 [Citrobacter braakii]
MSNTTWGLQRDITPSLGARLVQEGNRLHYLADRASITGKFSDAESLKLDVVFPHFISQMESMLTTGEMNPRHAHCVTLYH
NGFTCEADTLGSSGYVYIAVYLTQR

Download         Length: 318 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A483GLH7

Antitoxin

Source ID Structure

References