Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | yafW-ykfI/CbtA-CbeA |
Location | 3572011..3572690 | Replicon | chromosome |
Accession | NZ_CP126329 | ||
Organism | Citrobacter braakii strain THB2 |
Toxin (Protein)
Gene name | ykfI | Uniprot ID | - |
Locus tag | QN090_RS17330 | Protein ID | WP_023564453.1 |
Coordinates | 3572349..3572690 (+) | Length | 114 a.a. |
Antitoxin (Protein)
Gene name | yafW | Uniprot ID | S1EWR7 |
Locus tag | QN090_RS17325 | Protein ID | WP_000070396.1 |
Coordinates | 3572011..3572328 (+) | Length | 106 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QN090_RS17295 (3567699) | 3567699..3568604 | - | 906 | WP_139762569.1 | dihydrodipicolinate synthase family protein | - |
QN090_RS17300 (3568609) | 3568609..3569397 | - | 789 | WP_165474297.1 | IclR family transcriptional regulator | - |
QN090_RS17305 (3569597) | 3569597..3570577 | + | 981 | WP_000019403.1 | IS5-like element IS5 family transposase | - |
QN090_RS17310 (3570812) | 3570812..3571270 | + | 459 | WP_000211838.1 | antirestriction protein | - |
QN090_RS17315 (3571286) | 3571286..3571762 | + | 477 | WP_000811693.1 | RadC family protein | - |
QN090_RS17320 (3571771) | 3571771..3571992 | + | 222 | WP_000691994.1 | DUF987 domain-containing protein | - |
QN090_RS17325 (3572011) | 3572011..3572328 | + | 318 | WP_000070396.1 | type IV toxin-antitoxin system antitoxin YafW | Antitoxin |
QN090_RS17330 (3572349) | 3572349..3572690 | + | 342 | WP_023564453.1 | type IV toxin-antitoxin system toxin YkfI | Toxin |
QN090_RS17340 (3573313) | 3573313..3573657 | - | 345 | WP_284564636.1 | isoprenylcysteine carboxylmethyltransferase family protein | - |
QN090_RS17345 (3573971) | 3573971..3575419 | - | 1449 | WP_137367226.1 | EAL domain-containing protein | - |
QN090_RS17355 (3576369) | 3576369..3577088 | - | 720 | WP_094761452.1 | Crp/Fnr family transcriptional regulator | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | IScluster/Tn | - | - | 3569597..3576138 | 6541 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 12906.98 Da Isoelectric Point: 9.6543
>T282796 WP_023564453.1 NZ_CP126329:3572349-3572690 [Citrobacter braakii]
MKTLPATTQRAVKPCLSPVAVWQMLLTRLLEQHYGLTINDTPFCNEAVIKEHIDAGITLADAVNFLVEKYELVRIDRKGF
SWQEQSPYLRAADILRARQATGLLRQSRNNVIR
MKTLPATTQRAVKPCLSPVAVWQMLLTRLLEQHYGLTINDTPFCNEAVIKEHIDAGITLADAVNFLVEKYELVRIDRKGF
SWQEQSPYLRAADILRARQATGLLRQSRNNVIR
Download Length: 342 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|