Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 3406243..3406863 | Replicon | chromosome |
| Accession | NZ_CP126329 | ||
| Organism | Citrobacter braakii strain THB2 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | R8WYV2 |
| Locus tag | QN090_RS16540 | Protein ID | WP_002892050.1 |
| Coordinates | 3406645..3406863 (+) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | R8WZW8 |
| Locus tag | QN090_RS16535 | Protein ID | WP_003021733.1 |
| Coordinates | 3406243..3406617 (+) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QN090_RS16525 (3401390) | 3401390..3402583 | + | 1194 | WP_016152074.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
| QN090_RS16530 (3402606) | 3402606..3405755 | + | 3150 | WP_016152073.1 | efflux RND transporter permease AcrB | - |
| QN090_RS16535 (3406243) | 3406243..3406617 | + | 375 | WP_003021733.1 | Hha toxicity modulator TomB | Antitoxin |
| QN090_RS16540 (3406645) | 3406645..3406863 | + | 219 | WP_002892050.1 | HHA domain-containing protein | Toxin |
| QN090_RS16545 (3407044) | 3407044..3407595 | + | 552 | WP_016155874.1 | maltose O-acetyltransferase | - |
| QN090_RS16550 (3407712) | 3407712..3408182 | + | 471 | WP_047416865.1 | YlaC family protein | - |
| QN090_RS16555 (3408261) | 3408261..3408401 | - | 141 | WP_005125190.1 | type B 50S ribosomal protein L36 | - |
| QN090_RS16560 (3408403) | 3408403..3408663 | - | 261 | WP_016152070.1 | type B 50S ribosomal protein L31 | - |
| QN090_RS16565 (3408852) | 3408852..3410405 | + | 1554 | WP_047416867.1 | EAL domain-containing protein | - |
| QN090_RS16570 (3410457) | 3410457..3410810 | - | 354 | WP_003831033.1 | DUF1428 family protein | - |
| QN090_RS16575 (3410875) | 3410875..3411504 | - | 630 | WP_016155872.1 | membrane protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T282795 WP_002892050.1 NZ_CP126329:3406645-3406863 [Citrobacter braakii]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14427.23 Da Isoelectric Point: 5.5653
>AT282795 WP_003021733.1 NZ_CP126329:3406243-3406617 [Citrobacter braakii]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEQSNHGWVNDPTSATSLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEQSNHGWVNDPTSATSLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2P8K6F2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | R8WZW8 |