Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/UPF0150(antitoxin) |
| Location | 2251268..2251904 | Replicon | chromosome |
| Accession | NZ_CP126329 | ||
| Organism | Citrobacter braakii strain THB2 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | A0A2I8S6E9 |
| Locus tag | QN090_RS10975 | Protein ID | WP_049259794.1 |
| Coordinates | 2251268..2251456 (+) | Length | 63 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | - |
| Locus tag | QN090_RS10980 | Protein ID | WP_131382557.1 |
| Coordinates | 2251488..2251904 (+) | Length | 139 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QN090_RS10955 (2248046) | 2248046..2248276 | - | 231 | WP_016156585.1 | DUF2554 family protein | - |
| QN090_RS10960 (2248466) | 2248466..2248591 | - | 126 | WP_003020230.1 | DUF2474 domain-containing protein | - |
| QN090_RS10965 (2248591) | 2248591..2249601 | - | 1011 | WP_016153157.1 | cytochrome d ubiquinol oxidase subunit II | - |
| QN090_RS10970 (2249601) | 2249601..2251004 | - | 1404 | WP_137367004.1 | cytochrome ubiquinol oxidase subunit I | - |
| QN090_RS10975 (2251268) | 2251268..2251456 | + | 189 | WP_049259794.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| QN090_RS10980 (2251488) | 2251488..2251904 | + | 417 | WP_131382557.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| QN090_RS10985 (2251997) | 2251997..2253406 | + | 1410 | WP_202195551.1 | PLP-dependent aminotransferase family protein | - |
| QN090_RS10990 (2253736) | 2253736..2254881 | + | 1146 | WP_047417375.1 | ABC transporter substrate-binding protein | - |
| QN090_RS10995 (2254898) | 2254898..2255914 | + | 1017 | WP_016156582.1 | ABC transporter ATP-binding protein | - |
| QN090_RS11000 (2255915) | 2255915..2256859 | + | 945 | WP_016153152.1 | ABC transporter permease | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 63 a.a. Molecular weight: 7102.16 Da Isoelectric Point: 11.5775
>T282790 WP_049259794.1 NZ_CP126329:2251268-2251456 [Citrobacter braakii]
VKQSEFRRWLESQGVAVTNGSNHLKLRYQGRRSVMPRHPGDEIKEALRKSILKQLGLQSSSI
VKQSEFRRWLESQGVAVTNGSNHLKLRYQGRRSVMPRHPGDEIKEALRKSILKQLGLQSSSI
Download Length: 189 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 15064.33 Da Isoelectric Point: 4.7119
>AT282790 WP_131382557.1 NZ_CP126329:2251488-2251904 [Citrobacter braakii]
MRYPVNLIPAVEGGFVVSFPDIPEALTQGETRHGALQAAQSALVTAFEFYFDDNEPIPLPSAVGTEGDYVEIPLSIASKV
LLLNAFLESKITQQELANRIGRPKQEITRLFDLKHATKIDAVQIAARALGKELSVTML
MRYPVNLIPAVEGGFVVSFPDIPEALTQGETRHGALQAAQSALVTAFEFYFDDNEPIPLPSAVGTEGDYVEIPLSIASKV
LLLNAFLESKITQQELANRIGRPKQEITRLFDLKHATKIDAVQIAARALGKELSVTML
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|