Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
| Location | 872466..873120 | Replicon | chromosome |
| Accession | NZ_CP126329 | ||
| Organism | Citrobacter braakii strain THB2 | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | R8WN60 |
| Locus tag | QN090_RS04380 | Protein ID | WP_016154348.1 |
| Coordinates | 872713..873120 (+) | Length | 136 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | R8WMJ6 |
| Locus tag | QN090_RS04375 | Protein ID | WP_016154349.1 |
| Coordinates | 872466..872732 (+) | Length | 89 a.a. |
Genomic Context
Location: 870014..870325 (312 bp)
Type: Others
Protein ID: WP_075847454.1
Type: Others
Protein ID: WP_075847454.1
Location: 870489..871148 (660 bp)
Type: Others
Protein ID: WP_016154351.1
Type: Others
Protein ID: WP_016154351.1
Location: 872466..872732 (267 bp)
Type: Antitoxin
Protein ID: WP_016154349.1
Type: Antitoxin
Protein ID: WP_016154349.1
Location: 872713..873120 (408 bp)
Type: Toxin
Protein ID: WP_016154348.1
Type: Toxin
Protein ID: WP_016154348.1
Location: 873856..874752 (897 bp)
Type: Others
Protein ID: WP_016154346.1
Type: Others
Protein ID: WP_016154346.1
Location: 874776..875489 (714 bp)
Type: Others
Protein ID: WP_075847456.1
Type: Others
Protein ID: WP_075847456.1
Location: 875495..877228 (1734 bp)
Type: Others
Protein ID: WP_049269301.1
Type: Others
Protein ID: WP_049269301.1
Location: 867679..869112 (1434 bp)
Type: Others
Protein ID: WP_075847452.1
Type: Others
Protein ID: WP_075847452.1
Location: 869233..869961 (729 bp)
Type: Others
Protein ID: WP_075847608.1
Type: Others
Protein ID: WP_075847608.1
Location: 871228..872208 (981 bp)
Type: Others
Protein ID: WP_019077629.1
Type: Others
Protein ID: WP_019077629.1
Location: 873221..873742 (522 bp)
Type: Others
Protein ID: WP_016154347.1
Type: Others
Protein ID: WP_016154347.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QN090_RS04350 (867679) | 867679..869112 | - | 1434 | WP_075847452.1 | 6-phospho-beta-glucosidase BglA | - |
| QN090_RS04355 (869233) | 869233..869961 | - | 729 | WP_075847608.1 | MurR/RpiR family transcriptional regulator | - |
| QN090_RS04360 (870014) | 870014..870325 | + | 312 | WP_075847454.1 | N(4)-acetylcytidine aminohydrolase | - |
| QN090_RS04365 (870489) | 870489..871148 | + | 660 | WP_016154351.1 | hemolysin III family protein | - |
| QN090_RS04370 (871228) | 871228..872208 | - | 981 | WP_019077629.1 | tRNA-modifying protein YgfZ | - |
| QN090_RS04375 (872466) | 872466..872732 | + | 267 | WP_016154349.1 | FAD assembly factor SdhE | Antitoxin |
| QN090_RS04380 (872713) | 872713..873120 | + | 408 | WP_016154348.1 | protein YgfX | Toxin |
| QN090_RS04385 (873221) | 873221..873742 | - | 522 | WP_016154347.1 | flavodoxin FldB | - |
| QN090_RS04390 (873856) | 873856..874752 | + | 897 | WP_016154346.1 | site-specific tyrosine recombinase XerD | - |
| QN090_RS04395 (874776) | 874776..875489 | + | 714 | WP_075847456.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
| QN090_RS04400 (875495) | 875495..877228 | + | 1734 | WP_049269301.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| No matching records found | |||||||
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 15850.66 Da Isoelectric Point: 11.2845
>T282789 WP_016154348.1 NZ_CP126329:872713-873120 [Citrobacter braakii]
VVQWQSDLRVSWRAQWLSLLIHGLVAVFILLMPWPLSYTPLWLVLLSLVVFDSVRSQRRINACQGEIRLLMDGRLRWQGQ
EWTIASAPWMVKTGMMLRLRSDAGKRQHLWLAADSMDDAEWRDLRRLILQQAKQG
VVQWQSDLRVSWRAQWLSLLIHGLVAVFILLMPWPLSYTPLWLVLLSLVVFDSVRSQRRINACQGEIRLLMDGRLRWQGQ
EWTIASAPWMVKTGMMLRLRSDAGKRQHLWLAADSMDDAEWRDLRRLILQQAKQG
Download Length: 408 bp