Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) parDE/RelE-RHH
Location 69810..70357 Replicon plasmid pHL21A
Accession NZ_CP126326
Organism Salmonella enterica subsp. enterica strain HL21

Toxin (Protein)


Gene name parE Uniprot ID -
Locus tag QN088_RS23805 Protein ID WP_254880451.1
Coordinates 70079..70357 (+) Length 93 a.a.

Antitoxin (Protein)


Gene name parD Uniprot ID -
Locus tag QN088_RS23800 Protein ID WP_079955196.1
Coordinates 69810..70079 (+) Length 90 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QN088_RS23765 (QN088_23765) 65111..65254 + 144 Protein_82 DsbA family protein -
QN088_RS23770 (QN088_23770) 65285..65746 + 462 Protein_83 thioredoxin domain-containing protein -
QN088_RS23775 (QN088_23775) 66539..66703 + 165 WP_284546309.1 hypothetical protein -
QN088_RS23780 (QN088_23780) 66824..67369 + 546 WP_254880450.1 phospholipase D family protein -
QN088_RS23785 (QN088_23785) 67495..67752 + 258 WP_079975184.1 replication regulatory protein RepA -
QN088_RS23790 (QN088_23790) 68055..68924 + 870 WP_254880447.1 plasmid replication initiator RepA -
QN088_RS23795 (QN088_23795) 69507..69632 + 126 WP_284546310.1 hypothetical protein -
QN088_RS23800 (QN088_23800) 69810..70079 + 270 WP_079955196.1 type II toxin-antitoxin system antitoxin YacA Antitoxin
QN088_RS23805 (QN088_23805) 70079..70357 + 279 WP_254880451.1 type II toxin-antitoxin system toxin YacB Toxin
QN088_RS23810 (QN088_23810) 70654..71024 + 371 Protein_91 hypothetical protein -
QN088_RS23815 (QN088_23815) 71461..72017 + 557 Protein_92 Tn3 family transposase -
QN088_RS23820 (QN088_23820) 72319..72744 - 426 WP_284546311.1 hypothetical protein -
QN088_RS23825 (QN088_23825) 73424..73636 - 213 WP_284546312.1 hypothetical protein -
QN088_RS23830 (QN088_23830) 74099..74422 + 324 WP_284546313.1 aquaporin -
QN088_RS23835 (QN088_23835) 74723..75295 + 573 WP_284546314.1 tyrosine-type recombinase/integrase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid - - 1..90249 90249


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(3-91)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 93 a.a.        Molecular weight: 10806.38 Da        Isoelectric Point: 6.7253

>T282788 WP_254880451.1 NZ_CP126326:70079-70357 [Salmonella enterica subsp. enterica]
MEIFWTMLASQDRKRIREYIAEQNLMAAVALDEQISDSAGSLAEQPYKGRYGRAEDTRELVIHPHFVLVYEVDKQWGKVY
ILRVLHTAQKWP

Download         Length: 279 bp

Antitoxin


Download         Length: 90 a.a.        Molecular weight: 10235.79 Da        Isoelectric Point: 10.8729

>AT282788 WP_079955196.1 NZ_CP126326:69810-70079 [Salmonella enterica subsp. enterica]
MSQVNMSLRIDAELKDAFMAAAKSMDRNGSQLIRDFMRQTVERQHNAWFREQINAGRQQLKRGEVLPHDMVEASAAAWRD
KMMKKAAGK

Download         Length: 270 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References