Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | parDE/RelE-RHH |
| Location | 69810..70357 | Replicon | plasmid pHL21A |
| Accession | NZ_CP126326 | ||
| Organism | Salmonella enterica subsp. enterica strain HL21 | ||
Toxin (Protein)
| Gene name | parE | Uniprot ID | - |
| Locus tag | QN088_RS23805 | Protein ID | WP_254880451.1 |
| Coordinates | 70079..70357 (+) | Length | 93 a.a. |
Antitoxin (Protein)
| Gene name | parD | Uniprot ID | - |
| Locus tag | QN088_RS23800 | Protein ID | WP_079955196.1 |
| Coordinates | 69810..70079 (+) | Length | 90 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QN088_RS23765 (QN088_23765) | 65111..65254 | + | 144 | Protein_82 | DsbA family protein | - |
| QN088_RS23770 (QN088_23770) | 65285..65746 | + | 462 | Protein_83 | thioredoxin domain-containing protein | - |
| QN088_RS23775 (QN088_23775) | 66539..66703 | + | 165 | WP_284546309.1 | hypothetical protein | - |
| QN088_RS23780 (QN088_23780) | 66824..67369 | + | 546 | WP_254880450.1 | phospholipase D family protein | - |
| QN088_RS23785 (QN088_23785) | 67495..67752 | + | 258 | WP_079975184.1 | replication regulatory protein RepA | - |
| QN088_RS23790 (QN088_23790) | 68055..68924 | + | 870 | WP_254880447.1 | plasmid replication initiator RepA | - |
| QN088_RS23795 (QN088_23795) | 69507..69632 | + | 126 | WP_284546310.1 | hypothetical protein | - |
| QN088_RS23800 (QN088_23800) | 69810..70079 | + | 270 | WP_079955196.1 | type II toxin-antitoxin system antitoxin YacA | Antitoxin |
| QN088_RS23805 (QN088_23805) | 70079..70357 | + | 279 | WP_254880451.1 | type II toxin-antitoxin system toxin YacB | Toxin |
| QN088_RS23810 (QN088_23810) | 70654..71024 | + | 371 | Protein_91 | hypothetical protein | - |
| QN088_RS23815 (QN088_23815) | 71461..72017 | + | 557 | Protein_92 | Tn3 family transposase | - |
| QN088_RS23820 (QN088_23820) | 72319..72744 | - | 426 | WP_284546311.1 | hypothetical protein | - |
| QN088_RS23825 (QN088_23825) | 73424..73636 | - | 213 | WP_284546312.1 | hypothetical protein | - |
| QN088_RS23830 (QN088_23830) | 74099..74422 | + | 324 | WP_284546313.1 | aquaporin | - |
| QN088_RS23835 (QN088_23835) | 74723..75295 | + | 573 | WP_284546314.1 | tyrosine-type recombinase/integrase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | - | - | 1..90249 | 90249 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 93 a.a. Molecular weight: 10806.38 Da Isoelectric Point: 6.7253
>T282788 WP_254880451.1 NZ_CP126326:70079-70357 [Salmonella enterica subsp. enterica]
MEIFWTMLASQDRKRIREYIAEQNLMAAVALDEQISDSAGSLAEQPYKGRYGRAEDTRELVIHPHFVLVYEVDKQWGKVY
ILRVLHTAQKWP
MEIFWTMLASQDRKRIREYIAEQNLMAAVALDEQISDSAGSLAEQPYKGRYGRAEDTRELVIHPHFVLVYEVDKQWGKVY
ILRVLHTAQKWP
Download Length: 279 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|