Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VagC |
Location | 55753..56378 | Replicon | plasmid pHL21A |
Accession | NZ_CP126326 | ||
Organism | Salmonella enterica subsp. enterica strain HL21 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | QN088_RS23715 | Protein ID | WP_000911322.1 |
Coordinates | 55753..56151 (-) | Length | 133 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | A0A8F2UQ48 |
Locus tag | QN088_RS23720 | Protein ID | WP_000450263.1 |
Coordinates | 56151..56378 (-) | Length | 76 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QN088_RS23695 (QN088_23695) | 50909..51388 | + | 480 | WP_284546307.1 | surface exclusion protein | - |
QN088_RS23700 (QN088_23700) | 51734..52465 | + | 732 | WP_079975227.1 | conjugal transfer complement resistance protein TraT | - |
QN088_RS23705 (QN088_23705) | 52690..53196 | + | 507 | WP_254880449.1 | hypothetical protein | - |
QN088_RS23710 (QN088_23710) | 53474..55744 | + | 2271 | WP_284546308.1 | type IV conjugative transfer system coupling protein TraD | - |
QN088_RS23715 (QN088_23715) | 55753..56151 | - | 399 | WP_000911322.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
QN088_RS23720 (QN088_23720) | 56151..56378 | - | 228 | WP_000450263.1 | toxin-antitoxin system antitoxin VapB | Antitoxin |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | - | - | 1..90249 | 90249 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 14887.13 Da Isoelectric Point: 8.5264
>T282787 WP_000911322.1 NZ_CP126326:c56151-55753 [Salmonella enterica subsp. enterica]
MLKFMLDTNICIFTIKNKPASVRERFNLNQGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRLDVLDYDTPAATHT
GQIRAELARQGRPVGPFDQMIAGHARSRGLIVVTNNTREFERVGGLRTEDWS
MLKFMLDTNICIFTIKNKPASVRERFNLNQGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRLDVLDYDTPAATHT
GQIRAELARQGRPVGPFDQMIAGHARSRGLIVVTNNTREFERVGGLRTEDWS
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|