Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 7375..8018 Replicon plasmid pHL21A
Accession NZ_CP126326
Organism Salmonella enterica subsp. enterica strain HL21

Toxin (Protein)


Gene name vagD Uniprot ID -
Locus tag QN088_RS23395 Protein ID WP_284546338.1
Coordinates 7375..7791 (-) Length 139 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID A0A6C0NE67
Locus tag QN088_RS23400 Protein ID WP_008322219.1
Coordinates 7788..8018 (-) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QN088_RS23360 (QN088_23360) 2658..3188 + 531 WP_284546333.1 hypothetical protein -
QN088_RS23365 (QN088_23365) 3268..3816 + 549 WP_284546334.1 hypothetical protein -
QN088_RS23370 (QN088_23370) 3997..4404 + 408 WP_284546335.1 hypothetical protein -
QN088_RS23375 (QN088_23375) 4434..4940 + 507 WP_284546336.1 hypothetical protein -
QN088_RS23380 (QN088_23380) 5123..5320 + 198 Protein_5 transposase -
QN088_RS23385 (QN088_23385) 5340..6035 + 696 WP_079975203.1 aquaporin Z -
QN088_RS23390 (QN088_23390) 6374..6799 + 426 WP_284546337.1 hypothetical protein -
QN088_RS23395 (QN088_23395) 7375..7791 - 417 WP_284546338.1 type II toxin-antitoxin system VapC family toxin Toxin
QN088_RS23400 (QN088_23400) 7788..8018 - 231 WP_008322219.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
QN088_RS23405 (QN088_23405) 8762..8980 + 219 WP_079975208.1 type II toxin-antitoxin system antitoxin CcdA -
QN088_RS23410 (QN088_23410) 8982..9287 + 306 WP_001159874.1 type II toxin-antitoxin system toxin CcdB -
QN088_RS23415 (QN088_23415) 9289..9579 + 291 WP_001266174.1 hypothetical protein -
QN088_RS23420 (QN088_23420) 9576..10076 + 501 WP_284546339.1 3'-5' exonuclease -
QN088_RS23425 (QN088_23425) 10264..10722 + 459 Protein_14 3'-5' exonuclease -
QN088_RS23430 (QN088_23430) 10757..11539 + 783 WP_015059761.1 site-specific integrase -
QN088_RS23435 (QN088_23435) 11682..12623 - 942 WP_000728920.1 Rpn family recombination-promoting nuclease/putative transposase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid - - 1..90249 90249


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(5-129)

Antitoxin

SpoVT-AbrB domain

(7-50)


Sequences

Toxin        


Download         Length: 139 a.a.        Molecular weight: 15101.65 Da        Isoelectric Point: 7.2158

>T282785 WP_284546338.1 NZ_CP126326:c7791-7375 [Salmonella enterica subsp. enterica]
VKKMYMLDTNICSFIMCEQPEAVLKRLEQAVLRGHRIMVSAITYSEMRFGATGPKASPRHIELVDAFCARLDAVLPWDRA
AVDATTEIKVALRLAGTPIGPNDTAIAGHAIAAGAVLVTNNVREFERVPGLVLEDWVK

Download         Length: 417 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8736.84 Da        Isoelectric Point: 4.4692

>AT282785 WP_008322219.1 NZ_CP126326:c8018-7788 [Salmonella enterica subsp. enterica]
MRTVSIFKNGNNRAIRLPRDLDFEGVSELEIVREGDSIILRPVRPTWGSFAQLEKADPDFMAEREDVVTDEGRFNL

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure
AlphaFold DB A0A6C0NE67

References