Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/LOTUS_5_Limkain_b1(toxin)
Location 4635447..4636063 Replicon chromosome
Accession NZ_CP126325
Organism Salmonella enterica subsp. enterica strain HL21

Toxin (Protein)


Gene name vapC Uniprot ID A0A3Z6QPG7
Locus tag QN088_RS22410 Protein ID WP_000238496.1
Coordinates 4635447..4635821 (-) Length 125 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID A0A8E9YHE9
Locus tag QN088_RS22415 Protein ID WP_001523745.1
Coordinates 4635821..4636063 (-) Length 81 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QN088_RS22395 (4632949) 4632949..4633851 + 903 WP_000331364.1 formate dehydrogenase subunit beta -
QN088_RS22400 (4633848) 4633848..4634483 + 636 WP_000829025.1 formate dehydrogenase cytochrome b556 subunit -
QN088_RS22405 (4634480) 4634480..4635409 + 930 WP_085354113.1 formate dehydrogenase accessory protein FdhE -
QN088_RS22410 (4635447) 4635447..4635821 - 375 WP_000238496.1 type II toxin-antitoxin system VapC family toxin Toxin
QN088_RS22415 (4635821) 4635821..4636063 - 243 WP_001523745.1 CopG family transcriptional regulator Antitoxin
QN088_RS22420 (4636267) 4636267..4637196 + 930 WP_023245404.1 alpha/beta hydrolase -
QN088_RS22425 (4637282) 4637282..4637593 + 312 WP_000558163.1 type II toxin-antitoxin system HigB family toxin -
QN088_RS22430 (4637590) 4637590..4638036 + 447 WP_001259011.1 type II toxin-antitoxin system HigA family antitoxin -
QN088_RS22435 (4638051) 4638051..4638992 - 942 WP_001518251.1 fatty acid biosynthesis protein FabY -
QN088_RS22440 (4639037) 4639037..4639474 - 438 WP_000560969.1 D-aminoacyl-tRNA deacylase -
QN088_RS22445 (4639471) 4639471..4640343 - 873 WP_000921423.1 virulence factor BrkB family protein -
QN088_RS22450 (4640337) 4640337..4640936 - 600 WP_000965695.1 glucose-1-phosphatase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(7-115)

Antitoxin

Ribbon-helix-helix protein, CopG

(13-47)


Sequences

Toxin        


Download         Length: 125 a.a.        Molecular weight: 13936.24 Da        Isoelectric Point: 8.0689

>T282783 WP_000238496.1 NZ_CP126325:c4635821-4635447 [Salmonella enterica subsp. enterica]
MVKGSALFDTNILIDLFSGRIEAKHALEAYPPRNAISLITWMEVMVGAKKYHQENRTRIALSAFNIIGVTQEIAERSVIV
RQEYGMKLPDAIILATAQVHRCELVTRNTKDFADIPGVITPYHL

Download         Length: 375 bp

Antitoxin


Download         Length: 81 a.a.        Molecular weight: 9437.77 Da        Isoelectric Point: 4.4463

>AT282783 WP_001523745.1 NZ_CP126325:c4636063-4635821 [Salmonella enterica subsp. enterica]
MMAGMDMGRILLDLSDDVIKRLDDLKVQRNLPRAELLREAVEQYLERQDRAETTISKALGLWQGCEEDGVEYQRKLREEW

Download         Length: 243 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A3Z6QPG7

Antitoxin

Source ID Structure

References