Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/LOTUS_5_Limkain_b1(toxin) |
| Location | 4635447..4636063 | Replicon | chromosome |
| Accession | NZ_CP126325 | ||
| Organism | Salmonella enterica subsp. enterica strain HL21 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | A0A3Z6QPG7 |
| Locus tag | QN088_RS22410 | Protein ID | WP_000238496.1 |
| Coordinates | 4635447..4635821 (-) | Length | 125 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | A0A8E9YHE9 |
| Locus tag | QN088_RS22415 | Protein ID | WP_001523745.1 |
| Coordinates | 4635821..4636063 (-) | Length | 81 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QN088_RS22395 (4632949) | 4632949..4633851 | + | 903 | WP_000331364.1 | formate dehydrogenase subunit beta | - |
| QN088_RS22400 (4633848) | 4633848..4634483 | + | 636 | WP_000829025.1 | formate dehydrogenase cytochrome b556 subunit | - |
| QN088_RS22405 (4634480) | 4634480..4635409 | + | 930 | WP_085354113.1 | formate dehydrogenase accessory protein FdhE | - |
| QN088_RS22410 (4635447) | 4635447..4635821 | - | 375 | WP_000238496.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| QN088_RS22415 (4635821) | 4635821..4636063 | - | 243 | WP_001523745.1 | CopG family transcriptional regulator | Antitoxin |
| QN088_RS22420 (4636267) | 4636267..4637196 | + | 930 | WP_023245404.1 | alpha/beta hydrolase | - |
| QN088_RS22425 (4637282) | 4637282..4637593 | + | 312 | WP_000558163.1 | type II toxin-antitoxin system HigB family toxin | - |
| QN088_RS22430 (4637590) | 4637590..4638036 | + | 447 | WP_001259011.1 | type II toxin-antitoxin system HigA family antitoxin | - |
| QN088_RS22435 (4638051) | 4638051..4638992 | - | 942 | WP_001518251.1 | fatty acid biosynthesis protein FabY | - |
| QN088_RS22440 (4639037) | 4639037..4639474 | - | 438 | WP_000560969.1 | D-aminoacyl-tRNA deacylase | - |
| QN088_RS22445 (4639471) | 4639471..4640343 | - | 873 | WP_000921423.1 | virulence factor BrkB family protein | - |
| QN088_RS22450 (4640337) | 4640337..4640936 | - | 600 | WP_000965695.1 | glucose-1-phosphatase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 125 a.a. Molecular weight: 13936.24 Da Isoelectric Point: 8.0689
>T282783 WP_000238496.1 NZ_CP126325:c4635821-4635447 [Salmonella enterica subsp. enterica]
MVKGSALFDTNILIDLFSGRIEAKHALEAYPPRNAISLITWMEVMVGAKKYHQENRTRIALSAFNIIGVTQEIAERSVIV
RQEYGMKLPDAIILATAQVHRCELVTRNTKDFADIPGVITPYHL
MVKGSALFDTNILIDLFSGRIEAKHALEAYPPRNAISLITWMEVMVGAKKYHQENRTRIALSAFNIIGVTQEIAERSVIV
RQEYGMKLPDAIILATAQVHRCELVTRNTKDFADIPGVITPYHL
Download Length: 375 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|