Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 4299107..4299888 | Replicon | chromosome |
Accession | NZ_CP126325 | ||
Organism | Salmonella enterica subsp. enterica strain HL21 |
Toxin (Protein)
Gene name | TacT2 | Uniprot ID | A0A0R9NZI3 |
Locus tag | QN088_RS20900 | Protein ID | WP_000625912.1 |
Coordinates | 4299107..4299598 (-) | Length | 164 a.a. |
Antitoxin (Protein)
Gene name | TacA2 | Uniprot ID | M7RNV8 |
Locus tag | QN088_RS20905 | Protein ID | WP_001110450.1 |
Coordinates | 4299595..4299888 (-) | Length | 98 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QN088_RS20875 (4294247) | 4294247..4296685 | - | 2439 | WP_001014138.1 | F4 (K88) fimbrial usher FaeD | - |
QN088_RS20880 (4296695) | 4296695..4297234 | - | 540 | WP_284546086.1 | fimbrial protein | - |
QN088_RS20885 (4297269) | 4297269..4297559 | - | 291 | WP_000773468.1 | PapB/FocB family fimbrial expression transcriptional regulator | - |
QN088_RS20890 (4298142) | 4298142..4298369 | + | 228 | WP_001519955.1 | hypothetical protein | - |
QN088_RS20895 (4298644) | 4298644..4298892 | - | 249 | Protein_4084 | IS481 family transposase | - |
QN088_RS20900 (4299107) | 4299107..4299598 | - | 492 | WP_000625912.1 | GNAT family N-acetyltransferase | Toxin |
QN088_RS20905 (4299595) | 4299595..4299888 | - | 294 | WP_001110450.1 | DUF1778 domain-containing protein | Antitoxin |
QN088_RS20910 (4300205) | 4300205..4300427 | + | 223 | Protein_4087 | hypothetical protein | - |
QN088_RS20915 (4300692) | 4300692..4301567 | + | 876 | WP_000921674.1 | AraC family transcriptional regulator | - |
QN088_RS20920 (4301564) | 4301564..4301851 | + | 288 | WP_001541332.1 | transcriptional regulator RtsB | - |
QN088_RS20925 (4301991) | 4301991..4302365 | + | 375 | WP_230320449.1 | Ig-like domain-containing protein | - |
QN088_RS20930 (4302660) | 4302660..4303565 | - | 906 | WP_284546087.1 | YjiK family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | faeI / faeH / faeH / faeF / faeE / faeD / faeC | 4286574..4302365 | 15791 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 164 a.a. Molecular weight: 17606.43 Da Isoelectric Point: 7.7297
>T282782 WP_000625912.1 NZ_CP126325:c4299598-4299107 [Salmonella enterica subsp. enterica]
MISSPEPLHAGHILTPFCCGVDSMDNWLKQRAMKNQTTGASRTFVCCGSDSSVLAYYSLASSAVTTNTAPGRFRRNMPDP
IPIVVLGRLAVDKSLHGQGVGRALVRDAGLRVIQVAETIGIRGMLVHALSDEAREFYQRVGFVPSPMDPMMLMVTLGDLV
ESV
MISSPEPLHAGHILTPFCCGVDSMDNWLKQRAMKNQTTGASRTFVCCGSDSSVLAYYSLASSAVTTNTAPGRFRRNMPDP
IPIVVLGRLAVDKSLHGQGVGRALVRDAGLRVIQVAETIGIRGMLVHALSDEAREFYQRVGFVPSPMDPMMLMVTLGDLV
ESV
Download Length: 492 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0R9NZI3 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0R9PGG6 |