Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-RelB |
Location | 4160469..4160985 | Replicon | chromosome |
Accession | NZ_CP126325 | ||
Organism | Salmonella enterica subsp. enterica strain HL21 |
Toxin (Protein)
Gene name | relE | Uniprot ID | A0A748AMU5 |
Locus tag | QN088_RS20170 | Protein ID | WP_023245374.1 |
Coordinates | 4160469..4160753 (-) | Length | 95 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | V7ISI8 |
Locus tag | QN088_RS20175 | Protein ID | WP_000212724.1 |
Coordinates | 4160743..4160985 (-) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QN088_RS20155 (4155585) | 4155585..4157237 | + | 1653 | WP_023243275.1 | alpha,alpha-phosphotrehalase | - |
QN088_RS20160 (4157646) | 4157646..4159784 | + | 2139 | WP_284546073.1 | anaerobic ribonucleoside-triphosphate reductase | - |
QN088_RS20165 (4160001) | 4160001..4160465 | + | 465 | WP_001009176.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
QN088_RS20170 (4160469) | 4160469..4160753 | - | 285 | WP_023245374.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
QN088_RS20175 (4160743) | 4160743..4160985 | - | 243 | WP_000212724.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
QN088_RS20180 (4161063) | 4161063..4162976 | - | 1914 | WP_023245375.1 | BglG family transcription antiterminator | - |
QN088_RS20185 (4162993) | 4162993..4163733 | - | 741 | WP_000779263.1 | KDGP aldolase family protein | - |
QN088_RS20190 (4163730) | 4163730..4164848 | - | 1119 | WP_023245376.1 | DgaE family pyridoxal phosphate-dependent ammonia lyase | - |
QN088_RS20195 (4164832) | 4164832..4165965 | - | 1134 | WP_219557355.1 | amidohydrolase/deacetylase family metallohydrolase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 10855.61 Da Isoelectric Point: 9.6743
>T282781 WP_023245374.1 NZ_CP126325:c4160753-4160469 [Salmonella enterica subsp. enterica]
MTYELEFDPRALKEWHKLGDTVKAQLKKKLADVLLNPRIDSARLNGLPDCYKIKLKSSGYRLVYQVRDDVVIVFVVAVGK
REHSAVYHDANERL
MTYELEFDPRALKEWHKLGDTVKAQLKKKLADVLLNPRIDSARLNGLPDCYKIKLKSSGYRLVYQVRDDVVIVFVVAVGK
REHSAVYHDANERL
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A748AMU5 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5H5JRI5 |