Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 3469336..3469956 | Replicon | chromosome |
| Accession | NZ_CP126325 | ||
| Organism | Salmonella enterica subsp. enterica strain HL21 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | V1H8E6 |
| Locus tag | QN088_RS16990 | Protein ID | WP_001280991.1 |
| Coordinates | 3469738..3469956 (+) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | V1H4V6 |
| Locus tag | QN088_RS16985 | Protein ID | WP_000344807.1 |
| Coordinates | 3469336..3469710 (+) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QN088_RS16975 (3464475) | 3464475..3465668 | + | 1194 | WP_001039202.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
| QN088_RS16980 (3465691) | 3465691..3468840 | + | 3150 | WP_001132508.1 | efflux RND transporter permease AcrB | - |
| QN088_RS16985 (3469336) | 3469336..3469710 | + | 375 | WP_000344807.1 | Hha toxicity modulator TomB | Antitoxin |
| QN088_RS16990 (3469738) | 3469738..3469956 | + | 219 | WP_001280991.1 | HHA domain-containing protein | Toxin |
| QN088_RS16995 (3470135) | 3470135..3470686 | + | 552 | WP_001278793.1 | maltose O-acetyltransferase | - |
| QN088_RS17000 (3470804) | 3470804..3471274 | + | 471 | WP_000136183.1 | YlaC family protein | - |
| QN088_RS17005 (3471330) | 3471330..3471470 | - | 141 | WP_001197749.1 | type B 50S ribosomal protein L36 | - |
| QN088_RS17010 (3471476) | 3471476..3471736 | - | 261 | WP_000801415.1 | type B 50S ribosomal protein L31 | - |
| QN088_RS17015 (3471961) | 3471961..3473511 | + | 1551 | WP_000213140.1 | EAL domain-containing protein | - |
| QN088_RS17025 (3473742) | 3473742..3474131 | + | 390 | WP_000961285.1 | MGMT family protein | - |
| QN088_RS17030 (3474164) | 3474164..3474733 | - | 570 | WP_000779802.1 | YbaY family lipoprotein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8613.97 Da Isoelectric Point: 8.9008
>T282776 WP_001280991.1 NZ_CP126325:3469738-3469956 [Salmonella enterica subsp. enterica]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14453.27 Da Isoelectric Point: 5.1444
>AT282776 WP_000344807.1 NZ_CP126325:3469336-3469710 [Salmonella enterica subsp. enterica]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|