Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) ccdAB/CcdA(antitoxin)
Location 16684..17209 Replicon plasmid pCY16A
Accession NZ_CP126324
Organism Salmonella enterica subsp. enterica strain CY16

Toxin (Protein)


Gene name ccdB Uniprot ID I3W3D5
Locus tag QN087_RS22875 Protein ID WP_001159863.1
Coordinates 16904..17209 (+) Length 102 a.a.

Antitoxin (Protein)


Gene name ccdA Uniprot ID M7S5D0
Locus tag QN087_RS22870 Protein ID WP_000813641.1
Coordinates 16684..16902 (+) Length 73 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QN087_RS22835 (QN087_22835) 11734..12588 + 855 WP_001746753.1 hypothetical protein -
QN087_RS22840 (QN087_22840) 12549..13133 + 585 WP_024138406.1 hypothetical protein -
QN087_RS22845 (QN087_22845) 13206..13418 + 213 WP_000063791.1 FaeA/PapI family transcriptional regulator -
QN087_RS22850 (QN087_22850) 13679..13840 + 162 WP_001816720.1 hypothetical protein -
QN087_RS22855 (QN087_22855) 13866..14714 + 849 WP_000175397.1 SdiA-regulated domain-containing protein -
QN087_RS22860 (QN087_22860) 15284..15712 - 429 WP_001746752.1 type II toxin-antitoxin system VapC family toxin -
QN087_RS22865 (QN087_22865) 15709..15939 - 231 WP_001261283.1 type II toxin-antitoxin system VapB family antitoxin -
QN087_RS22870 (QN087_22870) 16684..16902 + 219 WP_000813641.1 type II toxin-antitoxin system antitoxin CcdA Antitoxin
QN087_RS22875 (QN087_22875) 16904..17209 + 306 WP_001159863.1 type II toxin-antitoxin system toxin CcdB Toxin
QN087_RS22880 (QN087_22880) 17211..17501 + 291 WP_001266176.1 hypothetical protein -
QN087_RS22885 (QN087_22885) 17498..18019 + 522 WP_000198608.1 hypothetical protein -
QN087_RS22890 (QN087_22890) 18054..18836 + 783 WP_000082169.1 site-specific integrase -
QN087_RS22895 (QN087_22895) 18845..19396 + 552 WP_015059439.1 EAL domain-containing protein -
QN087_RS22900 (QN087_22900) 19583..20071 + 489 WP_001075507.1 CaiF/GrlA family transcriptional regulator -
QN087_RS22905 (QN087_22905) 20065..20550 + 486 WP_000905606.1 membrane protein -
QN087_RS22910 (QN087_22910) 20827..21114 - 288 WP_071530243.1 hypothetical protein -
QN087_RS22915 (QN087_22915) 21270..21830 + 561 WP_071785580.1 inverse autotransporter beta domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - faeH / faeI / fdeC / spvC / spvB 1..86649 86649
- flank IS/Tn - - 21897..22247 350


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin CcdB

(2-100)

Antitoxin

Post-segregation antitoxin CcdA

(2-72)


Sequences

Toxin        


Download         Length: 102 a.a.        Molecular weight: 11587.48 Da        Isoelectric Point: 6.9787

>T282765 WP_001159863.1 NZ_CP126324:16904-17209 [Salmonella enterica subsp. enterica]
MQFKVYTCKRESRYRLFVDVQSDIIDTPGRRMAVPLVSARLLSEKVPRDLYPVMHIGDEPYRLLTTDMTSVPATVIGEEV
ADLSLRENDIKNAINLMFRGI

Download         Length: 306 bp

Antitoxin


Download         Length: 73 a.a.        Molecular weight: 8314.16 Da        Isoelectric Point: 4.5203

>AT282765 WP_000813641.1 NZ_CP126324:16684-16902 [Salmonella enterica subsp. enterica]
MKQRITVTVDSDSYQLLKAYDVNISGLVSTTMQNEARRLRAERWQEENREGMAEVASFIEANGSFADDNRNW

Download         Length: 219 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB I3W3D5

Antitoxin

Source ID Structure
AlphaFold DB A0A656ICA6

References