Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
| Location | 3987119..3987779 | Replicon | chromosome |
| Accession | NZ_CP126323 | ||
| Organism | Salmonella enterica subsp. enterica strain CY16 | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | Q57K70 |
| Locus tag | QN087_RS19290 | Protein ID | WP_000244756.1 |
| Coordinates | 3987119..3987532 (-) | Length | 138 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | S5MU13 |
| Locus tag | QN087_RS19295 | Protein ID | WP_000351186.1 |
| Coordinates | 3987513..3987779 (-) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QN087_RS19270 (3983060) | 3983060..3984793 | - | 1734 | WP_000813390.1 | single-stranded-DNA-specific exonuclease RecJ | - |
| QN087_RS19275 (3984799) | 3984799..3985512 | - | 714 | WP_000745614.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
| QN087_RS19280 (3985536) | 3985536..3986432 | - | 897 | WP_000434302.1 | site-specific tyrosine recombinase XerD | - |
| QN087_RS19285 (3986545) | 3986545..3987066 | + | 522 | WP_001055885.1 | flavodoxin FldB | - |
| QN087_RS19290 (3987119) | 3987119..3987532 | - | 414 | WP_000244756.1 | protein YgfX | Toxin |
| QN087_RS19295 (3987513) | 3987513..3987779 | - | 267 | WP_000351186.1 | FAD assembly factor SdhE | Antitoxin |
| QN087_RS19300 (3988029) | 3988029..3989009 | + | 981 | WP_000874176.1 | tRNA-modifying protein YgfZ | - |
| QN087_RS19305 (3989125) | 3989125..3989784 | - | 660 | WP_000250289.1 | hemolysin III family protein | - |
| QN087_RS19310 (3989948) | 3989948..3990259 | - | 312 | WP_001182975.1 | N(4)-acetylcytidine aminohydrolase | - |
| QN087_RS19315 (3990417) | 3990417..3991850 | + | 1434 | WP_001230141.1 | 6-phospho-beta-glucosidase BglA | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 138 a.a. Molecular weight: 16183.15 Da Isoelectric Point: 10.7537
>T282761 WP_000244756.1 NZ_CP126323:c3987532-3987119 [Salmonella enterica subsp. enterica]
VVLWQSDLRVSWRAQWISLLIHGLVAAVILLMPWPLSYTPLWMILLSLVVFDCVRSQRRINTCQGEIKLLMDGRLRWQGQ
DWTLLRPPWLLKSGMVLRLRAESGRHQHLWLAADSMEEAEWRELRRILLQQPISGQH
VVLWQSDLRVSWRAQWISLLIHGLVAAVILLMPWPLSYTPLWMILLSLVVFDCVRSQRRINTCQGEIKLLMDGRLRWQGQ
DWTLLRPPWLLKSGMVLRLRAESGRHQHLWLAADSMEEAEWRELRRILLQQPISGQH
Download Length: 414 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A3Z1E9V5 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A5I0YWH4 |