Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VagC |
Location | 3976213..3976856 | Replicon | chromosome |
Accession | NZ_CP126323 | ||
Organism | Salmonella enterica subsp. enterica strain CY16 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | M7SD17 |
Locus tag | QN087_RS19225 | Protein ID | WP_000911336.1 |
Coordinates | 3976213..3976611 (-) | Length | 133 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | A0A5U5RH28 |
Locus tag | QN087_RS19230 | Protein ID | WP_031606523.1 |
Coordinates | 3976611..3976856 (-) | Length | 82 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QN087_RS19210 (3972890) | 3972890..3973471 | - | 582 | WP_001747403.1 | fimbrial protein | - |
QN087_RS19215 (3974190) | 3974190..3974822 | - | 633 | WP_000835265.1 | YfdX family protein | - |
QN087_RS19220 (3974869) | 3974869..3975405 | - | 537 | WP_001747404.1 | STM3031 family outer membrane protein | - |
QN087_RS19225 (3976213) | 3976213..3976611 | - | 399 | WP_000911336.1 | tRNA(fMet)-specific endonuclease VapC | Toxin |
QN087_RS19230 (3976611) | 3976611..3976856 | - | 246 | WP_031606523.1 | toxin-antitoxin system antitoxin VapB | Antitoxin |
QN087_RS19235 (3977046) | 3977046..3977297 | + | 252 | WP_001576352.1 | hypothetical protein | - |
QN087_RS19240 (3977577) | 3977577..3978383 | + | 807 | WP_001574939.1 | DUF1460 domain-containing protein | - |
QN087_RS19250 (3978668) | 3978668..3979444 | - | 777 | WP_001747405.1 | amidase activator ActS | - |
QN087_RS19255 (3979709) | 3979709..3980254 | + | 546 | WP_000133994.1 | isopentenyl-diphosphate Delta-isomerase | - |
QN087_RS19260 (3980330) | 3980330..3981847 | - | 1518 | WP_000003342.1 | lysine--tRNA ligase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Genomic island | - | - | 3967768..3978383 | 10615 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 14938.30 Da Isoelectric Point: 7.2155
>T282760 WP_000911336.1 NZ_CP126323:c3976611-3976213 [Salmonella enterica subsp. enterica]
MLKFMLDTNTCIFTIKNKPEHIRERFNLNTSRMCISSITLMELIYGAEKSLAPERNLAVVEGFISRLEVLDYDTQAAIHT
GQIRAELARKGTPVGPYDQMIAGHAGSRGLVVVTNNLREFERIPGIRIEDWC
MLKFMLDTNTCIFTIKNKPEHIRERFNLNTSRMCISSITLMELIYGAEKSLAPERNLAVVEGFISRLEVLDYDTQAAIHT
GQIRAELARKGTPVGPYDQMIAGHAGSRGLVVVTNNLREFERIPGIRIEDWC
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
PDB | 6IFC | |
PDB | 6IFM |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5U5RH28 |