Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | shpAB/BrnT-BrnA |
| Location | 807210..807786 | Replicon | chromosome |
| Accession | NZ_CP126323 | ||
| Organism | Salmonella enterica subsp. enterica strain CY16 | ||
Toxin (Protein)
| Gene name | shpA | Uniprot ID | M7RG88 |
| Locus tag | QN087_RS03825 | Protein ID | WP_001131963.1 |
| Coordinates | 807210..807497 (+) | Length | 96 a.a. |
Antitoxin (Protein)
| Gene name | shpB | Uniprot ID | B5R9R5 |
| Locus tag | QN087_RS03830 | Protein ID | WP_000063142.1 |
| Coordinates | 807484..807786 (+) | Length | 101 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QN087_RS03805 (802363) | 802363..802497 | + | 135 | WP_001055725.1 | hypothetical protein | - |
| QN087_RS03810 (802529) | 802529..803782 | - | 1254 | WP_001206756.1 | N-6 DNA methylase | - |
| QN087_RS03815 (803942) | 803942..804361 | - | 420 | WP_001720162.1 | restriction endonuclease subunit S | - |
| QN087_RS03820 (804974) | 804974..806814 | - | 1841 | Protein_749 | 3'-5' exonuclease | - |
| QN087_RS03825 (807210) | 807210..807497 | + | 288 | WP_001131963.1 | BrnT family toxin | Toxin |
| QN087_RS03830 (807484) | 807484..807786 | + | 303 | WP_000063142.1 | BrnA antitoxin family protein | Antitoxin |
| QN087_RS03835 (807861) | 807861..808817 | - | 957 | WP_000187842.1 | GTPase | - |
| QN087_RS03840 (808828) | 808828..809031 | - | 204 | WP_000460616.1 | YbdD/YjiX family protein | - |
| QN087_RS03845 (809126) | 809126..811276 | - | 2151 | WP_000379928.1 | pyruvate/proton symporter BtsT | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 11294.80 Da Isoelectric Point: 9.5894
>T282751 WP_001131963.1 NZ_CP126323:807210-807497 [Salmonella enterica subsp. enterica]
MPMEFEWDANKAKSNLRKHGVRFEDAVLVFDDPRHLSRQERYENGEYRWQTLGLVHGIVVILVAHSVRFESGFEVIRIIS
ARKADRKERNRYEHG
MPMEFEWDANKAKSNLRKHGVRFEDAVLVFDDPRHLSRQERYENGEYRWQTLGLVHGIVVILVAHSVRFESGFEVIRIIS
ARKADRKERNRYEHG
Download Length: 288 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| PDB | 7VD7 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| PDB | 7VD7 | |
| AlphaFold DB | A0A4D6PB01 |