Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | ccdAB/CcdA(antitoxin) |
| Location | 761494..762044 | Replicon | chromosome |
| Accession | NZ_CP126323 | ||
| Organism | Salmonella enterica subsp. enterica strain CY16 | ||
Toxin (Protein)
| Gene name | ccdB | Uniprot ID | A0A764IVN5 |
| Locus tag | QN087_RS03600 | Protein ID | WP_001199742.1 |
| Coordinates | 761736..762044 (+) | Length | 103 a.a. |
Antitoxin (Protein)
| Gene name | ccdA | Uniprot ID | M7RP97 |
| Locus tag | QN087_RS03595 | Protein ID | WP_001118105.1 |
| Coordinates | 761494..761733 (+) | Length | 80 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QN087_RS03565 (756933) | 756933..757964 | - | 1032 | WP_000453347.1 | L-idonate 5-dehydrogenase | - |
| QN087_RS03570 (758181) | 758181..758711 | + | 531 | WP_000896758.1 | gluconokinase | - |
| QN087_RS03575 (758739) | 758739..759758 | - | 1020 | WP_000152558.1 | NAD(P)-dependent alcohol dehydrogenase | - |
| QN087_RS03585 (760515) | 760515..761060 | + | 546 | WP_223557450.1 | helix-turn-helix domain-containing protein | - |
| QN087_RS03590 (761137) | 761137..761385 | + | 249 | WP_000168388.1 | ribbon-helix-helix domain-containing protein | - |
| QN087_RS03595 (761494) | 761494..761733 | + | 240 | WP_001118105.1 | type II toxin-antitoxin system CcdA family antitoxin | Antitoxin |
| QN087_RS03600 (761736) | 761736..762044 | + | 309 | WP_001199742.1 | CcdB family protein | Toxin |
| QN087_RS03605 (762450) | 762450..762590 | + | 141 | Protein_706 | Arm DNA-binding domain-containing protein | - |
| QN087_RS03610 (762622) | 762622..763755 | - | 1134 | Protein_707 | IS3 family transposase | - |
| QN087_RS03615 (764077) | 764077..764607 | + | 531 | WP_000909461.1 | SEF14 fimbria major subunit SefA | - |
| QN087_RS03620 (764729) | 764729..765469 | + | 741 | WP_001746655.1 | SEF14/SEF18 fimbria chaperone SefB | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | IScluster/Tn | - | - | 760560..763663 | 3103 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 103 a.a. Molecular weight: 11826.62 Da Isoelectric Point: 6.4785
>T282750 WP_001199742.1 NZ_CP126323:761736-762044 [Salmonella enterica subsp. enterica]
MQYMVYHNKGNSKAYPYLLDVQSDIIDELHTRMVIPLFPVSRLVNNPVKRLTPTLNVEGNDYLVMTHEMASIRLSQIGDE
VMDVRSHRQTIKNALDFIFDGF
MQYMVYHNKGNSKAYPYLLDVQSDIIDELHTRMVIPLFPVSRLVNNPVKRLTPTLNVEGNDYLVMTHEMASIRLSQIGDE
VMDVRSHRQTIKNALDFIFDGF
Download Length: 309 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A764IVN5 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A5H9SZK8 |