Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/ParE-RelB |
| Location | 721329..721845 | Replicon | chromosome |
| Accession | NZ_CP126323 | ||
| Organism | Salmonella enterica subsp. enterica strain CY16 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | A0A756PF38 |
| Locus tag | QN087_RS03400 | Protein ID | WP_000220583.1 |
| Coordinates | 721561..721845 (+) | Length | 95 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | V7ISI8 |
| Locus tag | QN087_RS03395 | Protein ID | WP_000212724.1 |
| Coordinates | 721329..721571 (+) | Length | 81 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QN087_RS03375 (716349) | 716349..717482 | + | 1134 | WP_000459957.1 | amidohydrolase/deacetylase family metallohydrolase | - |
| QN087_RS03380 (717466) | 717466..718584 | + | 1119 | WP_001139169.1 | DgaE family pyridoxal phosphate-dependent ammonia lyase | - |
| QN087_RS03385 (718581) | 718581..719321 | + | 741 | WP_000779259.1 | KDGP aldolase family protein | - |
| QN087_RS03390 (719338) | 719338..721251 | + | 1914 | WP_001212128.1 | BglG family transcription antiterminator | - |
| QN087_RS03395 (721329) | 721329..721571 | + | 243 | WP_000212724.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
| QN087_RS03400 (721561) | 721561..721845 | + | 285 | WP_000220583.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| QN087_RS03405 (721849) | 721849..722313 | - | 465 | WP_001268859.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
| QN087_RS03410 (722435) | 722435..724573 | - | 2139 | WP_000187818.1 | anaerobic ribonucleoside-triphosphate reductase | - |
| QN087_RS03415 (724982) | 724982..726630 | - | 1649 | Protein_669 | alpha,alpha-phosphotrehalase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 10896.62 Da Isoelectric Point: 9.6743
>T282749 WP_000220583.1 NZ_CP126323:721561-721845 [Salmonella enterica subsp. enterica]
MTYELEFDPRALKEWHKLGDTVQAQLKKKLADVLLNPRIDSARLNDPPDCYKIKLKSSGYRLVYQVRDDVVIVFVVAVGK
REHSAVYHDANKRL
MTYELEFDPRALKEWHKLGDTVQAQLKKKLADVLLNPRIDSARLNDPPDCYKIKLKSSGYRLVYQVRDDVVIVFVVAVGK
REHSAVYHDANKRL
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A756PF38 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A5H5JRI5 |