Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
| Location | 614175..614956 | Replicon | chromosome |
| Accession | NZ_CP126323 | ||
| Organism | Salmonella enterica subsp. enterica strain CY16 | ||
Toxin (Protein)
| Gene name | TacT2 | Uniprot ID | B5R980 |
| Locus tag | QN087_RS02825 | Protein ID | WP_000626100.1 |
| Coordinates | 614465..614956 (+) | Length | 164 a.a. |
Antitoxin (Protein)
| Gene name | TacA2 | Uniprot ID | B5R979 |
| Locus tag | QN087_RS02820 | Protein ID | WP_001110452.1 |
| Coordinates | 614175..614468 (+) | Length | 98 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QN087_RS02785 (610230) | 610230..611132 | + | 903 | WP_020937303.1 | YjiK family protein | - |
| QN087_RS02790 (611422) | 611422..611553 | - | 132 | Protein_548 | hypothetical protein | - |
| QN087_RS02795 (611665) | 611665..611913 | - | 249 | Protein_549 | Ig-like domain-containing protein | - |
| QN087_RS02800 (611912) | 611912..612220 | + | 309 | WP_072095651.1 | ABC transporter ATP-binding protein | - |
| QN087_RS02805 (612213) | 612213..612499 | - | 287 | Protein_551 | transcriptional regulator RtsB | - |
| QN087_RS02810 (612496) | 612496..613371 | - | 876 | WP_000921680.1 | AraC family transcriptional regulator | - |
| QN087_RS02815 (613637) | 613637..613858 | - | 222 | WP_001576552.1 | hypothetical protein | - |
| QN087_RS02820 (614175) | 614175..614468 | + | 294 | WP_001110452.1 | DUF1778 domain-containing protein | Antitoxin |
| QN087_RS02825 (614465) | 614465..614956 | + | 492 | WP_000626100.1 | GNAT family N-acetyltransferase | Toxin |
| QN087_RS02830 (615204) | 615204..615956 | - | 753 | WP_000842432.1 | non-specific acid phosphatase | - |
| QN087_RS02835 (616056) | 616056..616133 | - | 78 | Protein_557 | porin family protein | - |
| QN087_RS02840 (616513) | 616513..616587 | + | 75 | Protein_558 | helix-turn-helix domain-containing protein | - |
| QN087_RS02850 (616858) | 616858..617433 | - | 576 | WP_001188509.1 | transcriptional regulator | - |
| QN087_RS02855 (617470) | 617470..619173 | - | 1704 | WP_000068885.1 | protein-disulfide reductase DsbD | - |
| QN087_RS02860 (619149) | 619149..619496 | - | 348 | WP_000887832.1 | divalent cation tolerance protein CutA | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 164 a.a. Molecular weight: 17645.45 Da Isoelectric Point: 7.7297
>T282748 WP_000626100.1 NZ_CP126323:614465-614956 [Salmonella enterica subsp. enterica]
MISTPEPLHAGHILTPFCCGVDSIDNWLKQRAMKNQTTGASRTFVCCGSDSNVLAYYSLASSAVTTNTSPGRFRRNMPDP
IPVVVLGRLAVDKSLHGQGVARALVRDAGLRVIQVAETIGIRGMLVHALSDEAREFYQRVGFVPSPMDPMMLMVTLGDLV
ESV
MISTPEPLHAGHILTPFCCGVDSIDNWLKQRAMKNQTTGASRTFVCCGSDSNVLAYYSLASSAVTTNTSPGRFRRNMPDP
IPVVVLGRLAVDKSLHGQGVARALVRDAGLRVIQVAETIGIRGMLVHALSDEAREFYQRVGFVPSPMDPMMLMVTLGDLV
ESV
Download Length: 492 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A656IQ80 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| PDB | 7AK7 | |
| AlphaFold DB | A0A5I1DGA4 |