Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-RelB
Location 306133..306719 Replicon chromosome
Accession NZ_CP126323
Organism Salmonella enterica subsp. enterica strain CY16

Toxin (Protein)


Gene name doc Uniprot ID A0A3V9X0E4
Locus tag QN087_RS01405 Protein ID WP_000174964.1
Coordinates 306351..306719 (+) Length 123 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID V7IU48
Locus tag QN087_RS01400 Protein ID WP_001522145.1
Coordinates 306133..306354 (+) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QN087_RS01375 (301154) 301154..302263 + 1110 WP_000822976.1 high-affinity branched-chain amino acid ABC transporter substrate-binding protein LivK -
QN087_RS01380 (302323) 302323..303249 + 927 WP_000016536.1 high-affinity branched-chain amino acid ABC transporter permease LivH -
QN087_RS01385 (303246) 303246..304523 + 1278 WP_000803764.1 branched chain amino acid ABC transporter permease LivM -
QN087_RS01390 (304520) 304520..305287 + 768 WP_000082080.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG -
QN087_RS01395 (305289) 305289..306002 + 714 WP_000416114.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF -
QN087_RS01400 (306133) 306133..306354 + 222 WP_001522145.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
QN087_RS01405 (306351) 306351..306719 + 369 WP_000174964.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
QN087_RS01410 (306978) 306978..308294 + 1317 WP_000624755.1 sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB -
QN087_RS01415 (308399) 308399..309286 + 888 WP_000099303.1 sn-glycerol-3-phosphate ABC transporter permease UgpA -
QN087_RS01420 (309283) 309283..310128 + 846 WP_000572194.1 sn-glycerol-3-phosphate ABC transporter permease UgpE -
QN087_RS01425 (310130) 310130..311200 + 1071 WP_000907835.1 sn-glycerol-3-phosphate import ATP-binding protein UgpC -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 303246..311937 8691


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Death on curing protein

(6-114)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-49)


Sequences

Toxin        


Download         Length: 123 a.a.        Molecular weight: 13601.91 Da        Isoelectric Point: 6.7252

>T282746 WP_000174964.1 NZ_CP126323:306351-306719 [Salmonella enterica subsp. enterica]
MTLQLISAEEIIQFHDRLLRVTPGVTGMPDPGRAEALMYRVLNQIEYEGVTDVWLLAAMHLLAISRGHIFNDGNKRTALF
ITLLFLKRNGISLAANPDFVDMTVDAAAGRLTLEQIVVRLRA

Download         Length: 369 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8166.17 Da        Isoelectric Point: 5.0775

>AT282746 WP_001522145.1 NZ_CP126323:306133-306354 [Salmonella enterica subsp. enterica]
MRTVNYSEARQNLAEVLESAVTAGPVTITRRGHKSAVIISAEEFERYQTARMDDEFAAIMAVHGNELRELADK

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A3V9X0E4

Antitoxin

Source ID Structure

References