Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC(toxin) |
| Location | 281336..281976 | Replicon | plasmid unnamed |
| Accession | NZ_CP126308 | ||
| Organism | Bosea vestrisii strain A18/4-2 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | QO058_RS30495 | Protein ID | WP_284173187.1 |
| Coordinates | 281590..281976 (+) | Length | 129 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | - |
| Locus tag | QO058_RS30490 | Protein ID | WP_284173185.1 |
| Coordinates | 281336..281590 (+) | Length | 85 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QO058_RS30470 (QO058_30470) | 278362..278757 | + | 396 | WP_284173181.1 | hypothetical protein | - |
| QO058_RS30475 (QO058_30475) | 279140..279349 | + | 210 | WP_284173182.1 | cold-shock protein | - |
| QO058_RS30480 (QO058_30480) | 279391..280095 | - | 705 | WP_284173183.1 | SMC-Scp complex subunit ScpB | - |
| QO058_RS30485 (QO058_30485) | 280099..281004 | - | 906 | WP_284173184.1 | DUF1403 family protein | - |
| QO058_RS30490 (QO058_30490) | 281336..281590 | + | 255 | WP_284173185.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
| QO058_RS30495 (QO058_30495) | 281590..281976 | + | 387 | WP_284173187.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| QO058_RS30500 (QO058_30500) | 281980..283068 | + | 1089 | WP_284173188.1 | site-specific integrase | - |
| QO058_RS30505 (QO058_30505) | 283089..283607 | - | 519 | WP_284173190.1 | RES family NAD+ phosphorylase | - |
| QO058_RS30510 (QO058_30510) | 283604..283993 | - | 390 | WP_284173191.1 | MbcA/ParS/Xre antitoxin family protein | - |
| QO058_RS30515 (QO058_30515) | 284171..284551 | - | 381 | WP_284173192.1 | hypothetical protein | - |
| QO058_RS30520 (QO058_30520) | 284529..284840 | - | 312 | WP_284173193.1 | WGR domain-containing protein | - |
| QO058_RS30525 (QO058_30525) | 284951..286180 | - | 1230 | WP_284173195.1 | plasmid replication protein RepC | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | - | 1..372254 | 372254 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 129 a.a. Molecular weight: 14095.96 Da Isoelectric Point: 4.6251
>T282744 WP_284173187.1 NZ_CP126308:281590-281976 [Bosea vestrisii]
MVIDTSAIVAIFFNEPDAPRYRERIADDPVRLMSAATLLEAAMVIEGRFGEAGGAELDLWLHKAEVEIVAVTAEHADQAR
RAWRRYGKGRHPASLNYGDCFSYALAALTGEPLLFKGEDFAQTDIQVA
MVIDTSAIVAIFFNEPDAPRYRERIADDPVRLMSAATLLEAAMVIEGRFGEAGGAELDLWLHKAEVEIVAVTAEHADQAR
RAWRRYGKGRHPASLNYGDCFSYALAALTGEPLLFKGEDFAQTDIQVA
Download Length: 387 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|