Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-Phd |
Location | 4688846..4689531 | Replicon | chromosome |
Accession | NZ_CP126307 | ||
Organism | Bosea vestrisii strain A18/4-2 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | QO058_RS23015 | Protein ID | WP_284168542.1 |
Coordinates | 4688846..4689271 (-) | Length | 142 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | - |
Locus tag | QO058_RS23020 | Protein ID | WP_284168543.1 |
Coordinates | 4689268..4689531 (-) | Length | 88 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QO058_RS22995 (QO058_22995) | 4684161..4685309 | + | 1149 | WP_284168538.1 | glycine cleavage system aminomethyltransferase GcvT | - |
QO058_RS23000 (QO058_23000) | 4685339..4685713 | + | 375 | WP_284168539.1 | glycine cleavage system protein GcvH | - |
QO058_RS23005 (QO058_23005) | 4685874..4687214 | + | 1341 | WP_284168540.1 | aminomethyl-transferring glycine dehydrogenase subunit GcvPA | - |
QO058_RS23010 (QO058_23010) | 4687214..4688788 | + | 1575 | WP_284168541.1 | aminomethyl-transferring glycine dehydrogenase subunit GcvPB | - |
QO058_RS23015 (QO058_23015) | 4688846..4689271 | - | 426 | WP_284168542.1 | PIN domain-containing protein | Toxin |
QO058_RS23020 (QO058_23020) | 4689268..4689531 | - | 264 | WP_284168543.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
QO058_RS23025 (QO058_23025) | 4689699..4691009 | + | 1311 | WP_284168544.1 | L,D-transpeptidase family protein | - |
QO058_RS23030 (QO058_23030) | 4691108..4691590 | - | 483 | WP_284173002.1 | ATP F0F1 synthase subunit B | - |
QO058_RS23035 (QO058_23035) | 4691599..4692153 | - | 555 | WP_284168545.1 | F0F1 ATP synthase subunit B | - |
QO058_RS23040 (QO058_23040) | 4692279..4692506 | - | 228 | WP_057187825.1 | F0F1 ATP synthase subunit C | - |
QO058_RS23045 (QO058_23045) | 4692568..4693314 | - | 747 | WP_126113486.1 | F0F1 ATP synthase subunit A | - |
QO058_RS23050 (QO058_23050) | 4693388..4693738 | - | 351 | WP_284168546.1 | AtpZ/AtpI family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 142 a.a. Molecular weight: 15620.96 Da Isoelectric Point: 5.7529
>T282742 WP_284168542.1 NZ_CP126307:c4689271-4688846 [Bosea vestrisii]
VRILLDTNVISEPQKPQPSAAVERFIRDTPEEGLFLSIITIAELYRSVAFMTEGRRRIRLSEWVTAELPERFGDRLLPIT
TSIAALWGDVMAQSRRDGLNMSIMDGFLAATAAAHGLAIATRNVRHFTGLGLTVIDPWGES
VRILLDTNVISEPQKPQPSAAVERFIRDTPEEGLFLSIITIAELYRSVAFMTEGRRRIRLSEWVTAELPERFGDRLLPIT
TSIAALWGDVMAQSRRDGLNMSIMDGFLAATAAAHGLAIATRNVRHFTGLGLTVIDPWGES
Download Length: 426 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|