Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-VapB |
| Location | 1657148..1657707 | Replicon | chromosome |
| Accession | NZ_CP126307 | ||
| Organism | Bosea vestrisii strain A18/4-2 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | QO058_RS08230 | Protein ID | WP_284171545.1 |
| Coordinates | 1657148..1657513 (-) | Length | 122 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | - |
| Locus tag | QO058_RS08235 | Protein ID | WP_284171546.1 |
| Coordinates | 1657510..1657707 (-) | Length | 66 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QO058_RS08210 (QO058_08210) | 1652249..1652815 | - | 567 | WP_284171541.1 | dihydrofolate reductase family protein | - |
| QO058_RS08215 (QO058_08215) | 1653120..1654412 | + | 1293 | WP_284171542.1 | adenylosuccinate synthase | - |
| QO058_RS08220 (QO058_08220) | 1654444..1655667 | + | 1224 | WP_284171543.1 | histidine kinase | - |
| QO058_RS08225 (QO058_08225) | 1655600..1657138 | - | 1539 | WP_284171544.1 | hypothetical protein | - |
| QO058_RS08230 (QO058_08230) | 1657148..1657513 | - | 366 | WP_284171545.1 | PIN domain-containing protein | Toxin |
| QO058_RS08235 (QO058_08235) | 1657510..1657707 | - | 198 | WP_284171546.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
| QO058_RS08240 (QO058_08240) | 1657786..1659408 | - | 1623 | WP_284171547.1 | peptide chain release factor 3 | - |
| QO058_RS08245 (QO058_08245) | 1659585..1661267 | + | 1683 | WP_284171548.1 | HAMP domain-containing methyl-accepting chemotaxis protein | - |
| QO058_RS08250 (QO058_08250) | 1661274..1662035 | - | 762 | WP_126115780.1 | ABC transporter permease | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 122 a.a. Molecular weight: 12946.03 Da Isoelectric Point: 6.6055
>T282739 WP_284171545.1 NZ_CP126307:c1657513-1657148 [Bosea vestrisii]
VILLDASVWIDHLRRGEPRLIGMLSEGDILIHPFVTAEVALGSIARRSTVIAVLDALPQAPVATHGEVMRLIAHEHLHGL
GIGYVDAHLLASARLADAGLWSRDRRLLAAAERLGVAAEAT
VILLDASVWIDHLRRGEPRLIGMLSEGDILIHPFVTAEVALGSIARRSTVIAVLDALPQAPVATHGEVMRLIAHEHLHGL
GIGYVDAHLLASARLADAGLWSRDRRLLAAAERLGVAAEAT
Download Length: 366 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|