Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC(toxin) |
| Location | 1241385..1242016 | Replicon | chromosome |
| Accession | NZ_CP126307 | ||
| Organism | Bosea vestrisii strain A18/4-2 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | QO058_RS06065 | Protein ID | WP_284171047.1 |
| Coordinates | 1241630..1242016 (+) | Length | 129 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | - |
| Locus tag | QO058_RS06060 | Protein ID | WP_284171046.1 |
| Coordinates | 1241385..1241633 (+) | Length | 83 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QO058_RS06050 (QO058_06050) | 1239266..1240177 | - | 912 | WP_284171043.1 | methylenetetrahydrofolate reductase [NAD(P)H] | - |
| QO058_RS06055 (QO058_06055) | 1240177..1241190 | - | 1014 | WP_284171045.1 | metalloregulator ArsR/SmtB family transcription factor | - |
| QO058_RS06060 (QO058_06060) | 1241385..1241633 | + | 249 | WP_284171046.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
| QO058_RS06065 (QO058_06065) | 1241630..1242016 | + | 387 | WP_284171047.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| QO058_RS06070 (QO058_06070) | 1242029..1243459 | - | 1431 | WP_284171049.1 | PLP-dependent aminotransferase family protein | - |
| QO058_RS06075 (QO058_06075) | 1243544..1244407 | + | 864 | WP_284171051.1 | DMT family transporter | - |
| QO058_RS06080 (QO058_06080) | 1244499..1245131 | - | 633 | WP_284171052.1 | MOSC domain-containing protein | - |
| QO058_RS06085 (QO058_06085) | 1245145..1245348 | - | 204 | WP_057190882.1 | cold-shock protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 129 a.a. Molecular weight: 13969.89 Da Isoelectric Point: 5.5960
>T282738 WP_284171047.1 NZ_CP126307:1241630-1242016 [Bosea vestrisii]
MIVDTSALVAILYREPEAEAFVKRIHAAETSRISVANYVELSMVVEHQLGPEGMRQAEAFFRRAGIIIEPVSVDHGDLAR
QAFLDFGKGRHRAGLNFGDCFAYALAKASGEPLLFKGNDFSQTDIAAA
MIVDTSALVAILYREPEAEAFVKRIHAAETSRISVANYVELSMVVEHQLGPEGMRQAEAFFRRAGIIIEPVSVDHGDLAR
QAFLDFGKGRHRAGLNFGDCFAYALAKASGEPLLFKGNDFSQTDIAAA
Download Length: 387 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|