Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/LOTUS_5_Limkain_b1-VagC
Location 735397..736031 Replicon chromosome
Accession NZ_CP126307
Organism Bosea vestrisii strain A18/4-2

Toxin (Protein)


Gene name vapC Uniprot ID -
Locus tag QO058_RS03525 Protein ID WP_284170355.1
Coordinates 735630..736031 (+) Length 134 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID -
Locus tag QO058_RS03520 Protein ID WP_284170354.1
Coordinates 735397..735633 (+) Length 79 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QO058_RS03495 (QO058_03495) 731151..731570 - 420 WP_284170337.1 50S ribosomal protein L17 -
QO058_RS03500 (QO058_03500) 731684..732700 - 1017 WP_110489267.1 DNA-directed RNA polymerase subunit alpha -
QO058_RS03505 (QO058_03505) 732793..733182 - 390 WP_043237079.1 30S ribosomal protein S11 -
QO058_RS03510 (QO058_03510) 733302..733670 - 369 WP_057193225.1 30S ribosomal protein S13 -
QO058_RS03515 (QO058_03515) 733899..735095 - 1197 WP_284170353.1 ABC transporter substrate-binding protein -
QO058_RS03520 (QO058_03520) 735397..735633 + 237 WP_284170354.1 antitoxin Antitoxin
QO058_RS03525 (QO058_03525) 735630..736031 + 402 WP_284170355.1 type II toxin-antitoxin system VapC family toxin Toxin
QO058_RS03530 (QO058_03530) 736060..736368 - 309 WP_284170357.1 alkylphosphonate utilization protein -
QO058_RS03535 (QO058_03535) 736444..737025 - 582 WP_129155110.1 adenylate kinase -
QO058_RS03540 (QO058_03540) 737025..738362 - 1338 WP_284170360.1 preprotein translocase subunit SecY -
QO058_RS03545 (QO058_03545) 738455..738934 - 480 WP_284170361.1 50S ribosomal protein L15 -
QO058_RS03550 (QO058_03550) 738947..739144 - 198 WP_057193241.1 50S ribosomal protein L30 -
QO058_RS03555 (QO058_03555) 739155..739718 - 564 WP_284170363.1 30S ribosomal protein S5 -
QO058_RS03560 (QO058_03560) 739853..740215 - 363 WP_284170364.1 50S ribosomal protein L18 -
QO058_RS03565 (QO058_03565) 740227..740760 - 534 WP_284170365.1 50S ribosomal protein L6 -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(4-125)

Antitoxin

SpoVT-AbrB domain

(10-45)


Sequences

Toxin        


Download         Length: 134 a.a.        Molecular weight: 14278.41 Da        Isoelectric Point: 4.6702

>T282737 WP_284170355.1 NZ_CP126307:735630-736031 [Bosea vestrisii]
MTRYLLDTNIISDLVRQPQGRVAKQIAEVGDRQVLTSAIVAAELRYGCRKAGSARLSATIEALLFEIETIPFDEAASRAY
ADLRTALEAKGQPIGGNDMLIAAQALALGCVMVTANVNEFARVDGLAIENWLG

Download         Length: 402 bp

Antitoxin


Download         Length: 79 a.a.        Molecular weight: 8737.06 Da        Isoelectric Point: 4.8228

>AT282737 WP_284170354.1 NZ_CP126307:735397-735633 [Bosea vestrisii]
MNEIRHVRLFRNGRNQAVRIPVEFELPGDEALMRRDGDRLVIEPLAKRGLTALLAGLEPLDEAFPEIADPPPAPERGL

Download         Length: 237 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References