Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/LOTUS_5_Limkain_b1-VagC |
| Location | 735397..736031 | Replicon | chromosome |
| Accession | NZ_CP126307 | ||
| Organism | Bosea vestrisii strain A18/4-2 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | QO058_RS03525 | Protein ID | WP_284170355.1 |
| Coordinates | 735630..736031 (+) | Length | 134 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | - |
| Locus tag | QO058_RS03520 | Protein ID | WP_284170354.1 |
| Coordinates | 735397..735633 (+) | Length | 79 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QO058_RS03495 (QO058_03495) | 731151..731570 | - | 420 | WP_284170337.1 | 50S ribosomal protein L17 | - |
| QO058_RS03500 (QO058_03500) | 731684..732700 | - | 1017 | WP_110489267.1 | DNA-directed RNA polymerase subunit alpha | - |
| QO058_RS03505 (QO058_03505) | 732793..733182 | - | 390 | WP_043237079.1 | 30S ribosomal protein S11 | - |
| QO058_RS03510 (QO058_03510) | 733302..733670 | - | 369 | WP_057193225.1 | 30S ribosomal protein S13 | - |
| QO058_RS03515 (QO058_03515) | 733899..735095 | - | 1197 | WP_284170353.1 | ABC transporter substrate-binding protein | - |
| QO058_RS03520 (QO058_03520) | 735397..735633 | + | 237 | WP_284170354.1 | antitoxin | Antitoxin |
| QO058_RS03525 (QO058_03525) | 735630..736031 | + | 402 | WP_284170355.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| QO058_RS03530 (QO058_03530) | 736060..736368 | - | 309 | WP_284170357.1 | alkylphosphonate utilization protein | - |
| QO058_RS03535 (QO058_03535) | 736444..737025 | - | 582 | WP_129155110.1 | adenylate kinase | - |
| QO058_RS03540 (QO058_03540) | 737025..738362 | - | 1338 | WP_284170360.1 | preprotein translocase subunit SecY | - |
| QO058_RS03545 (QO058_03545) | 738455..738934 | - | 480 | WP_284170361.1 | 50S ribosomal protein L15 | - |
| QO058_RS03550 (QO058_03550) | 738947..739144 | - | 198 | WP_057193241.1 | 50S ribosomal protein L30 | - |
| QO058_RS03555 (QO058_03555) | 739155..739718 | - | 564 | WP_284170363.1 | 30S ribosomal protein S5 | - |
| QO058_RS03560 (QO058_03560) | 739853..740215 | - | 363 | WP_284170364.1 | 50S ribosomal protein L18 | - |
| QO058_RS03565 (QO058_03565) | 740227..740760 | - | 534 | WP_284170365.1 | 50S ribosomal protein L6 | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 134 a.a. Molecular weight: 14278.41 Da Isoelectric Point: 4.6702
>T282737 WP_284170355.1 NZ_CP126307:735630-736031 [Bosea vestrisii]
MTRYLLDTNIISDLVRQPQGRVAKQIAEVGDRQVLTSAIVAAELRYGCRKAGSARLSATIEALLFEIETIPFDEAASRAY
ADLRTALEAKGQPIGGNDMLIAAQALALGCVMVTANVNEFARVDGLAIENWLG
MTRYLLDTNIISDLVRQPQGRVAKQIAEVGDRQVLTSAIVAAELRYGCRKAGSARLSATIEALLFEIETIPFDEAASRAY
ADLRTALEAKGQPIGGNDMLIAAQALALGCVMVTANVNEFARVDGLAIENWLG
Download Length: 402 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|